KEGG   Danio rerio (zebrafish): 558716Help
Entry
558716            CDS       T01004                                 

Gene name
galnt11
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 11
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    558716 (galnt11)
   00514 Other types of O-glycan biosynthesis
    558716 (galnt11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    558716 (galnt11)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     558716 (galnt11)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   558716 (galnt11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 558716
NCBI-ProteinID: NP_001070030
ZFIN: ZDB-GENE-060929-998
Ensembl: ENSDARG00000063636
Vega: OTTDARG00000028682
UniProt: F1R7M5 Q08CC3
LinkDB All DBs
Position
24
AA seq 590 aa AA seqDB search
MGSVTLRYFCYGCLFTSVTWSILLFLYFNLSQESRLSFRNVPVQGQHRFQPRFTRGPAVQ
HRDGSQVRKGQALEAVKPDLSPELGMIFNKQDQEVRDMGYHKHAFNVLISNRLGYHRDVP
DTRTDKCRDRAYSVSLPTASIVICFFNEAFSALLRTVHSVLDRTPNYLLHEIILVDDHSE
LDDLKEDLDSYVQQHLQKKVKVVRNEKREGLIRGRMIGASHATGEVLVFLDSHCEVNEAW
LQPLLTPIKENRKTVVCPVIDIISADTLVYTPSPIVRGGFNWGLHFKWDPVPMSELNSPD
GAIRSPTMAGGLFAMDRNYFYELGQYDRGMDIWGGENLEISFRIWMCGGQLLIVPCSRVG
HIFRKRRPYGSPGGQDTMAHNSLRLAHVWMDDYKEQYFALRPELRNRDYGDISERVSIRK
RLQCHSFKWYLDNIYPEMQVSSPHKPQQPVFINKGLKRPKVLQRGRLRNLLADKCLVAQG
RPSQKGGAVVVKDCDPQDPEQEWAYDEEHELVLAGLLCLDMSEIRSSDPPRLMKCHGSGG
SQQWTLGKKNWLYQVSVGQCLAVGDPLSIKGYVSMAICDDSRSQQWQLEG
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgtcactctgcgctacttttgttatggttgcctcttcacctccgtgacctgg
tcgattcttctgttcctctatttcaacctcagccaggaaagccgactatccttcagaaat
gtgcccgtccaggggcagcaccgttttcagcctcgttttacgcgtggccctgcagtccag
catagagatgggagtcaagtgcgtaaaggccaagcactggaagccgtcaagccagatctc
tctccagagctgggaatgatttttaacaagcaggaccaagaggtacgagatatgggctat
cataagcacgccttcaatgtactcatcagtaaccggctcggctaccacagagacgtccca
gacaccaggactgacaagtgcagggacagggcttattcagtgtccttgcccacagccagt
atagtgatctgtttcttcaatgaggcgttctctgccctcctgaggaccgttcacagtgtg
ctggatcgcacaccaaactacctgctccatgagatcatactggtggatgaccacagtgaa
ctggatgatctgaaggaagacttggattcttacgttcagcagcacctgcagaagaaagta
aaggtggttcgtaatgagaagagggaggggctgatccgcgggaggatgattggtgcatct
catgctacaggtgaggtgttggtgtttctggacagtcactgtgaggtgaatgaggcctgg
ctccagcctctgctcacccctattaaagagaacaggaaaactgtggtgtgcccagtcatc
gacatcatcagcgcagacacactagtatacaccccttctcctatcgttcgaggaggattc
aactggggcttgcactttaagtgggacccagtgcccatgtccgaactcaacagccctgat
ggagccattaggtctcctacgatggcaggtggactcttcgccatggacagaaattacttt
tatgagcttggtcagtacgaccgtggcatggatatatggggtggagagaacttggaaata
tcttttcggatttggatgtgtggaggccagttactgatcgttccctgctccagggtgggg
cacatcttccgcaagcgccggccgtatgggtcacctggaggtcaggatacaatggctcat
aattccctgcgtttggcccatgtctggatggatgactataaggagcagtactttgccttg
cggcctgagctgaggaaccgggactatggggacatcagtgagcgggtctctattcgcaag
cggctgcagtgtcactccttcaaatggtacctggacaatatataccccgaaatgcaggtg
tcctctccgcacaagccccagcagcctgtcttcatcaacaagggtttaaagagaccaaaa
gtactgcagcggggtcggttgcgtaatctcttggctgacaagtgtctggtggcacagggc
cgtcccagtcagaaggggggcgctgtggtggtgaaagactgtgacccacaggaccctgag
caggaatgggcatatgatgaggaacatgagttggttctagccgggctgctgtgtttggac
atgtcagagattcgttcctccgacccgccgcgcctcatgaagtgtcacggctctggtgga
tctcagcagtggacactggggaaaaagaactggctgtaccaggtgtcagtggggcagtgt
ttggctgtgggcgaccctctcagcatcaaagggtatgtttccatggcgatctgtgatgat
tcccgctctcagcaatggcagttggagggttga

DBGET integrated database retrieval system