KEGG   Danio rerio (zebrafish): 559020Help
Entry
559020            CDS       T01004                                 

Gene name
ptgs2b
Definition
(RefSeq) prostaglandin G/H synthase 2 precursor
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00590  Arachidonic acid metabolism
dre01100  Metabolic pathways
dre04370  VEGF signaling pathway
dre04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    559020 (ptgs2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    559020 (ptgs2b)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    559020 (ptgs2b)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     559020 (ptgs2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 559020
NCBI-ProteinID: NP_001020675
ZFIN: ZDB-GENE-041014-323
Ensembl: ENSDARG00000010276
Vega: OTTDARG00000006192
UniProt: Q5RI06
LinkDB All DBs
Position
20
AA seq 606 aa AA seqDB search
MKSSVLFIFLLLGFVVCTGANPCCSHPCQNRGVCTEMGSDAYECDCTRTGYYGQNCTTPE
FLTWVKVSLKPSPNTVHYILTHFKSLWNIINNVSFLRNGIMRYVLTSRAHLIDSPPTFNA
DYGYKSWEAYSNLSYYTRTLPPVPRDCPTPMGVAGKKELPDVKMLAEKLLLRRKFIPDPQ
RTNLMFAFFAQHFTHQFFKSDMKKGPAFTTALNHGVDLAHIYGQNLDRQHKLRLFKDGKL
RYQILDGEVYPPTVSEVQVDMHYPPHVPESRRFAVGHEAFGLVPGLMMYATIWLREHNRV
CDILKQEHPDWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYYFKLKFDPELLFNERFQ
YQNRISSEFNTLYHWHPLMPDDFHIQDEVYNYQQFLFNTSILTDYGVNSLVESFNKQIAG
RVAGGRNVAPAVLRVAIKSIENSRQMRYQSINAYRKRFNMKPYRSFEEMTGEKEMAAELE
EMYGDVDAVELYAGLLVEKPRSNAIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTFGG
KVGFEIVNSASLQNLVCNNVNGPCPMASFYVPNVKDSLPTTINASTSQSDRNVNPTVLLK
ERTSEL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttcggtattatttatttttttgcttctgggcttcgtggtttgcacaggagcg
aacccttgttgctcccatccctgtcagaatcgaggtgtctgtacggaaatgggctccgac
gcgtatgaatgtgactgtacacggactggatattacggtcaaaactgcacaacacccgag
tttctcacatgggtgaaagtctctctgaagccttctcccaacactgtgcattacattctc
acacacttcaaaagcttgtggaatattatcaacaacgtgtcgtttctgagaaacggcata
atgcgatacgtgctgacatcacgtgcccatctgatcgatagtcctcctacattcaatgct
gactatggttacaaaagctgggaagcctactctaatctctcctactatactcgcacatta
cctcctgtcccgcgtgattgcccaacgccaatgggagtcgcaggtaagaaagagctgcca
gacgtgaagatgctggcagagaaactgcttcttaggaggaagttcatcccagatcctcaa
cgcaccaatcttatgttcgctttcttcgcccaacattttactcaccagttcttcaaatct
gacatgaagaaaggtccagctttcacaacagccctgaaccatggggttgatttagctcat
atatatggacaaaaccttgatcgacaacacaagttgagacttttcaaggatggcaagttg
agatatcagattctggatggtgaggtttaccctccaacagtcagtgaggttcaagtagac
atgcattaccctcctcatgtacctgaatctcgtcgatttgctgtgggtcatgaggccttt
gggctggttcccggacttatgatgtacgccaccatctggctgcgtgaacataaccgagtg
tgcgacatactaaagcaggagcatcctgactgggatgatgagaggctgtttcagacctca
aggctcatccttattggtgagactattaagatcgtgatcgaagattacgtccagcacctt
agtggatactattttaagctcaagtttgatcccgaactactcttcaatgagcgtttccaa
taccagaacaggatctcctctgagttcaacacactttaccattggcaccccctcatgcct
gatgattttcacatccaggatgaagtctacaattatcagcagtttctcttcaacacttct
atcctgacagattatggcgtcaacagcttggttgagtccttcaacaaacagatagccgga
agggtagctggagggcgtaatgtagcaccagcagtgttaagggtggccattaagtcgatt
gaaaacagcaggcaaatgcgctaccaatcaatcaatgcttacaggaaacgcttcaacatg
aagccatacagatcctttgaagaaatgacaggagaaaaagaaatggctgctgaacttgaa
gagatgtacggagatgtggatgctgtggagctttatgctggtttgctggttgaaaagccc
aggtccaacgccatctttggggagaccatggttgagatgggtgcgccctactcccttaaa
ggacttatgggaaatcccatctgttccccagagtactggaaaccaagcacctttggtggg
aaagtgggctttgagattgtgaacagtgcctctctgcagaacttggtttgcaataatgtc
aacgggccatgtcctatggcgtccttttatgtgcctaatgtaaaagattcattacccacc
actattaatgcaagtacgtcccagtcagatcgaaatgtcaacccaactgttttactaaaa
gaaaggacatctgagctctga

DBGET integrated database retrieval system