KEGG   Danio rerio (zebrafish): 559073Help
Entry
559073            CDS       T01004                                 

Gene name
galnt1
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    559073 (galnt1)
   00514 Other types of O-glycan biosynthesis
    559073 (galnt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    559073 (galnt1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     559073 (galnt1)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   559073 (galnt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 559073
NCBI-ProteinID: XP_009290644
ZFIN: ZDB-GENE-030131-2360
Ensembl: ENSDARG00000061335
Vega: OTTDARG00000033321
UniProt: E7FDA0
LinkDB All DBs
Position
16
AA seq 557 aa AA seqDB search
MRKFAYCKVVLATSLVWVMLDMFILLYFSECNKCDDKKERGLPGRDTVVQRPHDGPGEMG
KPVVIAKDQQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVI
VFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVPVRVVR
MEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVIS
DDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDY
FQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQII
NKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDS
QIPRHYYSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLC
LDVSKLNGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSG
ARSQQWLLRNVTLPEIF
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagtttgcgtactgtaaggtggtgctggccacctctctggtgtgggtgatgcta
gacatgttcatcctcctctacttcagcgaatgcaacaagtgtgacgataaaaaggagaga
ggattgccggggagagacaccgtggttcagaggcctcatgatggccccggggagatgggc
aaaccagtggtcatcgctaaagaccagcaggagaagatgaaggaaatgtttaagataaac
cagtttaacctgatggccagcgagatgattgcgctcaaccgatcattaccggacgtccgg
ctcgagggatgtaaaacgaaagtgtatccagatgatctgccgcgcaccagtgtggtgatc
gtgtttcataatgaagcatggaccacactgctccggacggtgcacagcgtcatcgacagg
tcacctagacacctgctggaggagattgtcctggtggatgacgccagcgagagagacttc
ctaaagcggcagctggagcattatgtgcggaagttggaggttcctgtgagggtggtgaga
atggagcagcgctcaggcctgattcgcgctcggttgaagggggcatcaatctccacaggt
caggtgatcacctttctggatgcccactgtgagtgcaccaccggctggctcgagcctctg
ctctctcgcatcaaacttgacaagaaaaccgtagtgtgtcccatcattgacgtgatcagc
gatgacacgtttgagtacatggcaggctctgatatgacatatggtgggttcaactggaag
ctgaacttccgctggtatcctgtcccacagagagagatggaccgcaggaaaggagaccga
acgctgcctgtcaggaccccgacaatggcaggtggcctcttctccatagacagagattat
ttccaggagatcggcacatatgatgcaggaatggacatctggggaggagaaaacctggag
atctcatttaggatttggcagtgtggcgggacgcttgagattgtcacatgttctcacgtc
ggtcacgtgtttcgtaaagcaacgccttacacgttccctggtggaactgggcaaatcatc
aacaagaacaacagacggctggcagaggtctggatggacgagttcaagaacttcttctac
atcatctcacctggtgtgacgaaagtggattatggagacatctcaaccagaacatccctg
agacagagactgcaatgcaagcccttctcctggtacctggaaaatgtctacccagactca
cagataccacgccactactactcactgggagagatccgtaatgtggagactaaccagtgt
ctggataacatggccagaaaagagaatgagaaagtgggcattttcaactgccatggcatg
ggcggtaaccaggttttctcatacacagccaataaagagatccgaactgatgatctctgt
ttggatgtttccaaactcaatggcccggttatgatgctcaagtgccatcatttgaaaggc
aaccagctctgggaatatgaccctgtgaagctgagtctggtacacgtgaacagtaatcag
tgtttggataaggcatctgaagatgacagtcaggtgcccagcgtcagggactgcagcggg
gcccgttcacagcagtggcttctccgcaacgtcacactgcccgaaatattctga

DBGET integrated database retrieval system