KEGG   Danio rerio (zebrafish): 559945Help
Entry
559945            CDS       T01004                                 

Gene name
dot1l
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific isoform X1
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    559945 (dot1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    559945 (dot1l)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     559945 (dot1l)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     559945 (dot1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ PEP_mutase DUF3452
Motif
Other DBs
NCBI-GeneID: 559945
NCBI-ProteinID: XP_005170591
ZFIN: ZDB-GENE-060503-341
Ensembl: ENSDARG00000061992
LinkDB All DBs
Structure
PDB: 

Position
22
AA seq 1523 aa AA seqDB search
MGEKLELKLKSPVGAEAAGYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNKRPSNGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQIIDEMEMMEEDTFVDLGSGVGQVVLQVAAATNCK
HYYGVEKADIPATYAESMDKEFKRWMKWYGKKHGEYTLERGDFLSEEWKERIASTSVIFV
NNFAFGPEVDHQLKERFANMKEGGKIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLR
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEVARRRPQKDSKENKSNTTTPT
KPKEHKQAQHDSGGEEEPVVPVKPSPKPRRAKILTRGRKLGNRKRGRPKKAPAATAAERK
NKKSQSALDLLHAKTLSAAPAQEPYRSPQSPFYQLPPKVQHYTSSQLLMAPTPPGLQTLL
DNIKVQYLHFMAYMKTPQYRTNLQQSLEQEKLRHTELSSQAQQLVNACHAHKERIHDLFQ
SKLEELGVKAVTVEDLVQAQKEITAHNMQLREQTKQLEHDMAELRDQSQLLLKARCEELK
LDTLCWDTLKKEIEALRRQISEKQRHCLELQISIVELEKSQRQQELLQLKSSYSPCEVSP
YRKALPGPDPRPTLDPDTPKLTPQSSMGLNGLSPELSINGTASPGYERCTGSAMGKNELL
THYLPISPDHEIVPPTPDSRTRQLGQPLPDYTRFSPAKIALRRHLNQDSAANQFRALGNI
HRGDTGAISSPTLGFKQASPCSSEVQAVTTAKSTDRADKEKSPTAPGDTITSLPISIPLS
TVHPSKLPVSIPLASVVLPNRVERLRSTLSPVLNPAGQSNGKPPLTPTSGYSSSSGLVNG
SHSTMLTEDQDCDVASPPPHSTPVMGLQPRGSGLSPPLGTGGVLQYADGPPRLPPEDGHE
RQGPESDTEPLDSEARRRIFFSSSSSSSSSSSSTGGSRLHHGSVKQGHHHHSKHHHHHHH
HHHHHSPSSHSQEGRKRGRRKRSSSGAVPMSGSPKRRVFPGLGCSSHSSGSPLNINSMVN
NINQPLEISAISSPEQSGRSPCEQDLDQPPVLKRERPLELNNTGRYSSAPSSDEEGNGYA
PDTSSSSRIERKIATISLDRDGPVRDLERGLQGRKSGASSVSSEVSSSSGTSKWKSTFSP
ISDPKPTPPDIRQGGSPFSVGASRGGTDSDSDHKPQRRGEREREPYGNSNLFLSQDGSGR
SAVNTSERSLQKQKVREWDLKSVSGLASQNLFISAAASGGILSGKVGGAATVSSASAVGQ
YFPLGGASVLQPLFGTQAAGPATSGAPRLVNGHSALGSFSSAGLAGGAAGGIFHHMVSSS
SSQQSGPNLPSSHNSQQRHLDTNPKAGASFLASGPNRTQTVLHAPSPPTLALPPPPPLLN
TVPSQPSSPRSSRPQSSIPVATSSQSLAAASSSCTSSASSRPFTVHYPPHLQPPGSAGSG
GTGASWRTLASYTASQIPGNRPR
NT seq 4572 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaagctggagttaaaactgaagtcgccggtcggagccgaagctgcaggctat
ccgtggcccttacctgtatatgataaacatcatgatgctgcacacgaaatcatcgaaacc
attcgctgggtgtgtgaagagatcccagatcttaagctggccatggagaactacgttctt
attgactatgacaccaagagcttcgagagtatgcagagactatgtgataagtacaacaga
gccatcgacagcattcaccaactgtggaaagggaccacccagcctatgaaactgaacaag
cggccttccaatggcttgctgcgtcacatcctgcagcaggtctacaaccactctgtcacc
gacccggaaaaactcaacaactacgagccattttctccagaggtatacggagagacctcc
ttcgacctggtggctcaaatcatcgacgagatggagatgatggaggaagacacctttgtg
gatctgggcagtggggtcggtcaggtggtcctgcaagttgctgcggccaccaattgtaaa
cactactatggcgtggagaaagcagacattccagctacctatgcagaatcaatggacaaa
gagtttaagaggtggatgaagtggtatggcaaaaaacatggcgagtacacgctggaaagg
ggagatttcctttcagaagaatggaaggaacgaatagccagtacaagtgttatttttgtg
aataactttgcctttggtcctgaggtggaccaccagttgaaggaacgattcgccaacatg
aaggaaggtggaaaaattgtttcctctaaaccatttgcacctcttaacttcagaataaac
agccgaaacttgagtgatattggcacaataatgcgagttgtggagctgtcccctctgagg
ggttcggtgtcctggacagggaagccagtctcgtactatctgcatacaatagaccgcacc
atacttgaaaactatttttctagtctcaaaaatcctaaactcagggaggaacaggaggtt
gccagaaggcgcccacagaaggacagtaaagagaacaagagcaacaccaccaccccgacc
aagcctaaagagcacaagcaggcgcagcatgattcgggtggtgaagaggagccagttgtc
cccgtgaagccgtcacccaaaccccgccgggccaaaattctgaccaggggccgcaagctt
ggcaacaggaagcgcgggcgacccaagaaggcaccagctgcaactgcagccgagcgcaag
aacaagaagagccagagcgccctcgacctgctgcacgccaagaccctctcagcggcccct
gctcaggaaccataccggtcacctcagagtccgttctatcagctacctcccaaagtgcag
cattacacatccagccagctcctcatggctcccactccacctggcctgcagacgctactg
gataacatcaaagtccagtacctgcacttcatggcctacatgaagacgccacagtaccgc
accaacctgcagcaatcgcttgagcaggagaagctgagacacacagaactgtcaagtcaa
gcccagcagctggtcaacgcttgtcatgctcacaaggagaggattcatgaccttttccag
tccaaactagaagagctgggtgtgaaggcggtgacggtggaggatctggttcaggctcag
aaggagattacagcccacaacatgcagctgcgcgaacagaccaaacagctggagcatgac
atggccgagctccgagatcagagccagctgctgctgaaggctcgctgtgaggagctcaag
ctggacactctgtgttgggacactctgaagaaagagatagaagctctgcggagacagatc
tctgagaaacagcgccactgtctggagctccagatcagtatagttgaactcgagaagagc
cagcgacagcaggagctccttcagctcaagtcatcctacagcccttgtgaagtgtccccc
tacagaaaagccctccctggccctgatcctcggcccacactggacccggataccccaaaa
ctcaccccgcaatcctctatggggctgaacggcctcagtcctgaactctctatcaacggc
actgcctctccgggttatgaaagatgcaccggaagtgcaatgggcaaaaacgaactcctc
acccactacctgcccatttctccagaccacgaaattgtgccgccaaccccggactccaga
accaggcagcttgggcaacccctgcccgactacacccgcttttctccagcaaagatcgcc
ctccgcaggcacctcaaccaggattcagccgcaaaccagttccgggcactcggaaacatc
catcggggcgacactggtgccatttcatctccaacactgggctttaaacaggcttcacca
tgttcctcggaagttcaagcggtcaccacagccaagagcacagatagggccgataaagaa
aagagcccgactgcacccggcgacactataaccagtctaccaatcagcatccctctcagc
actgtgcatcccagcaaacttcctgtcagcatccctctggccagtgtggtgctgccgaac
cgcgtcgaaagactgaggagcactcttagtccggtattgaatccagcaggacagagcaat
ggcaagccacctctcacgcctacctcagggtactcctccagctcaggattggttaatggg
tctcactccaccatgctgaccgaggaccaagactgtgatgttgcctcccctcctcctcac
agcactcccgtcatgggtcttcagccccgcggctctggcctcagtcctccactgggcacc
ggaggcgttctccagtacgccgacggtccaccaaggcttccccccgaggatggccatgag
cgccaaggccccgaatccgacacagagcccttagatagtgaggctcgccggcgcattttt
ttctcttcatcctcctcttcttcctcatcctcatcctccactggaggctcgaggctgcac
catgggtctgtaaagcagggtcaccatcatcacagtaagcaccatcaccaccaccaccac
catcatcaccatcactctccaagctcccacagccaagagggccgaaaacgaggaagacga
aagcgcagctcatctggagccgtgcccatgagtggatcccccaaaagaagggtctttcct
ggactgggctgctcaagtcattcctctggatcaccgcttaatatcaattcaatggtaaac
aacataaaccagcctttggagatctccgccatttcttccccagagcagtcaggcagaagc
ccatgtgagcaagatctggatcagccacctgttttgaaacgagagcgtcctcttgagctc
aacaacaccggccgttattcctctgccccaagttcagatgaagaaggcaatggttacgcc
ccggacacctctagttcaagccgaattgaacgaaaaattgctactatttccttagaccga
gatggaccagttagagacttggaaagaggtttacagggacgtaaatcaggtgccagcagc
gtgagcagcgaggtatcctcttcctccggaaccagcaagtggaaatccaccttctccccc
atttctgatcccaagccaactcctccagacatccgccaaggtggctcaccatttagcgtt
ggagcttcccgaggaggcacagactcagactcggaccacaaaccccagaggagaggggag
cgtgagcgtgagccttatggaaattcaaatctcttcctcagtcaggatggcagtggtcgc
tcggcggtaaacacgtcagagcgttcgctgcagaaacagaaagtgcgggagtgggacctg
aaatctgtaagtggattggccagtcaaaacctatttatatctgcagcagccagtggaggc
atcctgagtgggaaagtgggcggggctgccactgtgtcatccgcctctgcggtagggcaa
tatttcccactgggcggagcttctgttctacaacccttatttggaactcaggcagcggga
ccagccaccagcggagccccccgattggtcaacggacattcggcgcttggcagtttctcc
agtgccggactggcagggggcgctgcaggagggatttttcaccacatggtgtcttcaagc
tcctcacagcagtctgggcccaatctcccaagctcccataattcccaacagaggcatctg
gacacgaaccccaaagcaggggcctcgttcttggcctctggccctaaccgcactcaaacg
gtcctacacgcaccctctccacccacgctcgctcttcccccgcccccacccctcctgaac
actgtcccgtcccaaccgtcctctccgcgctcatccagaccgcagtcgtccatccccgtg
gccacctcgtcccaatccctggctgccgcgtcctcttcctgcacctcatccgcttcctca
aggcccttcactgtccactatcctccgcatctgcagcctccgggcagcgctggttcaggt
gggacgggggcctcctggaggactctggcatcctatacggcctcgcagattcctgggaat
cggcccagataa

DBGET integrated database retrieval system