KEGG   Danio rerio (zebrafish): 561287Help
Entry
561287            CDS       T01004                                 

Gene name
f13a1b
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     561287 (f13a1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core FixG_C Cohesin Trs65 TRAPPC9-Trs120
Motif
Other DBs
NCBI-GeneID: 561287
NCBI-ProteinID: NP_001070622
ZFIN: ZDB-GENE-030131-9634
Ensembl: ENSDARG00000036893
Vega: OTTDARG00000035389
UniProt: Q08CA3
LinkDB All DBs
Position
7
AA seq 742 aa AA seqDB search
MADQVAPENPTPAAAPTVRPKQRVSHRGRSAGGRASSNQQEGKVEEFEPFMLMPRGPPPL
TEYLDIFDVDVLKQPNEVNKQAHHTHLYSSNFLIVRRAQEFQIKITFNRPYKPAEDKFAV
EFVIGPVPQYSKGTYIPVFPTAKRQSVWSGRVIESSENVVTMGITPSAECIVGKYMTYIG
VETPYGIRRTRRDPNTDIYILFNPWSPADPVFLDDEEEREECVMNELGIIYHGAYDDVSE
RAWNYGQFEFGVLDACLFVMDKADMPLSNRGDVVKVTRVASAMLNSRDDDGVLVGNWSGD
YMYGVPPTSWTGSVEILLDHANSSGTPVCYAQCWVYAAVFNTFLRCLGIPSRVVTNFFSA
HDNDGNLKMDIILDENGKLDRNRTKDSIWNYHCWNECYMARPDLPSGFGGWQVVDATPQE
TSDGMFRCGPASVAAIKHGQICYPFDAPFVFAEVNSDVVFYRRRKDGILEVVKVNQTHVG
RMVLTKAVLHSGRRDITNQYKFPEGSPEERRVLEKAEEFGCQREKSSPALSDVDVEIHSL
DVNVGENFDVTLQFTNRSDQRRTADVYITGTVVYYTGVPSGEVVFKTPKVKLEPMQSKEE
KVLVRSEDYMNKLVEQRNIHFIATGKIKETGQIITAMKVIAMHHPKLTVKVTGSPRVSEE
MYVSVEFTNPFKFSLENVDLRVEGPGVLPFKYKQYSVIAPGTSITWTEAFSPRRAGSTKV
FAKLDCAALRQVYGETELTVQE
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcaagtggctccagagaacccgacccctgctgctgcacccaccgttcggccc
aaacagcgggtgtcccaccgtggacgcagcgcaggaggcagagccagctccaatcaacaa
gagggcaaggtggaggagtttgagcccttcatgctgatgcccagaggacctccaccactc
actgagtatctggatatctttgatgtggatgtgctcaaacagcctaatgaagtgaataaa
caggctcatcacacacacctttactccagcaacttcctcatcgtgcgccgagctcaagag
tttcagatcaagatcaccttcaatcgaccctacaaaccggctgaagacaagtttgcggtt
gagtttgttataggaccggttcctcagtacagtaaaggcacctacattcccgtcttcccc
actgcgaagcggcagagcgtctggagcggccgggtcatcgaaagcagtgaaaatgtggtc
acgatgggcatcactccctcagcagagtgcattgtgggaaaatacatgacctacatcggt
gtggagacaccgtacggcatccgcaggaccaggagagacccaaacactgacatctatatc
cttttcaacccgtggtcaccagctgatccggtgtttctggatgacgaggaggaacgtgag
gagtgtgtaatgaatgaactcgggatcatctatcatggagcatatgatgatgtgtctgaa
cgcgcctggaactacggacagtttgagtttggagttctggatgcatgtctgttcgtcatg
gataaagctgatatgccgctgtcaaaccgaggtgatgtcgttaaagtgactcgcgtcgct
tcagcaatgctgaactctcgtgatgatgacggagtgttggtgggaaactggagtggggat
tacatgtacggagtgccgccgacgtcctggacgggcagcgttgagatcctattggaccac
gccaacagtagtggaactccagtctgctatgctcagtgctgggtctacgccgctgtcttc
aacaccttcctgcgatgtctcgggatccccagcagagtcgtgaccaacttcttttctgct
cacgacaatgacggcaacctgaagatggacataatcctggatgaaaatgggaaactggac
cggaaccgcaccaaagactccatctggaattatcattgctggaacgagtgctacatggcc
aggcctgatctgccttcagggtttggaggttggcaggttgtggacgcaacgccacaggag
accagcgatggtatgtttaggtgtggacctgcgtctgtagctgccataaaacatggtcag
atctgctacccgtttgatgccccctttgtgtttgcagaggtgaacagtgacgtggtcttt
tatcgtagacgtaaagacggtattctggaagtcgtgaaggtgaatcagactcatgtgggc
cggatggtgctgaccaaagctgtgctgcacagtggacgtcgagacattacaaaccagtac
aagttccctgaagggagcccggaggagcggcgtgtgctggagaaagctgaggagttcggc
tgtcagcgggagaaatcctctcctgctctgagcgatgtggacgtggagatccacagtctg
gatgttaatgtaggggaaaactttgatgtcactctgcagttcaccaaccgcagtgaccag
cgccgcacggcagacgtctacatcaccgggacagtggtgtattatactggagtcccgagc
ggagaggtcgtgtttaagacacctaaagtcaaactagagccaatgcagagtaaagaggag
aaagtgctggtccgcagcgaggactacatgaacaaactggtggagcagagaaacatccac
ttcatcgctacagggaagattaaagagacgggacagatcatcacagccatgaaagtcatc
gcaatgcaccatcccaaactcaccgtcaaggtcacaggctctccgagggtgagtgaggaa
atgtacgtgtctgttgagttcacaaaccctttcaagttcagtctggagaacgtggatctg
cgtgtggagggtcccggagtcctgcccttcaaatacaagcagtacagtgtgattgctcca
ggcacctctataacgtggactgaggcgttcagccctcgacgggccggatctactaaagtg
tttgccaaactggactgtgctgctctcagacaggtgtacggagagacggagctcactgtc
caagaatga

DBGET integrated database retrieval system