KEGG   Danio rerio (zebrafish): 561416Help
Entry
561416            CDS       T01004                                 

Gene name
pfkpb
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00010  Glycolysis / Gluconeogenesis
dre00030  Pentose phosphate pathway
dre00051  Fructose and mannose metabolism
dre00052  Galactose metabolism
dre01100  Metabolic pathways
dre01200  Carbon metabolism
dre01230  Biosynthesis of amino acids
dre03018  RNA degradation
Module
dre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    561416 (pfkpb)
   00030 Pentose phosphate pathway
    561416 (pfkpb)
   00051 Fructose and mannose metabolism
    561416 (pfkpb)
   00052 Galactose metabolism
    561416 (pfkpb)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    561416 (pfkpb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dre01009]
    561416 (pfkpb)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dre03019]
    561416 (pfkpb)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     561416 (pfkpb)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     561416 (pfkpb)
Messenger RNA biogenesis [BR:dre03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     561416 (pfkpb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 561416
NCBI-ProteinID: XP_005163618
ZFIN: ZDB-GENE-070912-634
Ensembl: ENSDARG00000012801
Vega: OTTDARG00000025162
LinkDB All DBs
Position
2
AA seq 784 aa AA seqDB search
MPDTKKYIENLSGAGKCIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQGMVD
GGDNIKEASWESVSSMLQVGGTVIGSARCKDFRTHEGRLCAALNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLDELVQSGQISEDAAQTHSALHIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPERPPKDGWE
EQMCQKLSENRADKKRLNIIIVAEGAIDQNNKPITTDHIKDLVVSRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEASPGTPACVVSLCGNQAVRVPLMECVQMTQEVQK
AMDEKRFEEAVKLRGRSFENNLNTYKLLSHRKIDTELPHSSFNVAVLNVGAPAAGMNAAV
RSAVRVGITEGHTMFAVSDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPAKHVD
KIAEQMRIHNINALLVIGGFEAYLGLMELQAARSKHAELCVPMVMVPATVSNNIPGSDLS
IGADTAINAITDTCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIYEEP
FDIRDLQSNVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKIAAKAMQWISKKLKEFYRDDEGRVFANTEDSACLLGMRRRA
LLFQPVVQLKDETDFVHRIPKEQWWLRLRPLMKILAKYKTSYDVSDSGQLEHIVRLRAKD
SSAI
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgccggacactaaaaaatacatcgagaatctctctggagcggggaagtgcatcggcgtc
ctgacgagcggaggagatgctcaaggtatgaatgctgctgtgagggcagtggtcagaatg
ggaatctatgtaggagcaaaggtttattttatccatgagggctaccagggcatggtggat
ggaggcgataacatcaaggaggcatcatgggaaagtgtttccagtatgttacaagtgggt
ggcacagtgatcggcagtgcccgatgtaaggatttccgcacacacgaggggcgtttgtgt
gccgccctgaacctggttcaacgtggtatcaccaacctgtgtgtgattggtggagacggc
agtttgaccggtgctaatctcttcagggaggagtggagcggactgctggatgagcttgtc
caatcaggtcagatcagcgaggatgctgcccaaactcattctgccctgcatatcgtcggg
atggtgggctctatagataatgatttctgtgggacagatatgaccattggcactgactca
gcactgcacaggatcatagaggtggtggacgctattatgaccacagcgcagagccatcag
aggacctttgtgctggaggttatggggagacactgtgggtatctagcattagtcagtgct
cttgcgtgtggtgctgactgggtgctgattccagaacggcctcctaaagacggctgggag
gaacagatgtgtcagaaactatcagagaatcgtgctgataagaaacggcttaatatcatc
atagtagctgaaggtgcgatagaccaaaacaacaagcccataaccacagaccatataaag
gacctggtcgtgagccggttggggtttgacactcgggtcaccattctgggccacgtccag
agaggaggaaccccctctgcctttgaccggattctggccagtcgcatgggagtggaggcc
gttttggctcttctcgaagcgtctcctggtactccagcatgtgtggtgtctctgtgtgga
aatcaggcggtcagggtccctctgatggagtgcgttcagatgactcaggaggttcaaaag
gccatggatgaaaagagattcgaagaagccgtgaagctgcgtggcagaagtttcgaaaac
aacctgaacacctacaaactcttgtctcaccgcaaaattgacacagagcttccacatagt
tcgtttaatgtggccgtgttgaatgttggcgctcctgcggctggtatgaatgctgccgtg
cgctcagcagttagagtcggcatcactgaaggacacaccatgtttgctgtgagcgacggg
tttgagggcttctacaaaggacagataaaagaaatcaagtggggggatgttgggggctgg
acggggcagggcgggtccctgctaggaacaaaacgaaccctcccagcaaaacatgtggat
aaaattgcagagcagatgaggattcacaacataaacgctttactggttattgggggattt
gaggcatatttgggtctgatggagctccaagcagctcgctccaaacacgcagagctatgt
gtgccgatggtgatggtcccggccactgtgtccaacaatattcccggctcagacctgagc
atcggggcagacacggccatcaacgccatcacagacacgtgtgaccgtataaagcagtcg
gccagcgggacgaagcgtcgcgtgttcattatcgagaccatggggggttattgtggatat
ctggcaaccgtaggtggtcttgcagctggagctgatgctgcgtacatctacgaggagccg
tttgacatccgagacctgcagtctaacgtcgagcatttaacagagaagatgaagaccagc
atccagagaggactagtgctcaggaatgagaacagcaatgagaactacaccactgacttc
atctatcagctgtactctgaagagggtaaaggagtgtttgactgcaggaagaatgtcctg
ggacacatgcagcagggtggcgctccttcaccatttgacaggaactttggcacgaagatc
gcagctaaagccatgcaatggatctccaagaagctcaaagagttttacagagacgatgaa
ggccgtgtgtttgcgaacactgaagactctgcatgtttgctggggatgcggcgcagggct
ctgctcttccagcctgttgttcagctcaaagacgagacagattttgttcacagaatcccg
aaggagcagtggtggctccgtctgcggccgctcatgaagattctggccaaatacaaaacc
agctacgacgtgtcggattcaggccagctggagcacatcgtccggctccgagctaaagac
agctccgccatttaa

DBGET integrated database retrieval system