KEGG   Danio rerio (zebrafish): 562149Help
Entry
562149            CDS       T01004                                 

Gene name
sdhb
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00020  Citrate cycle (TCA cycle)
dre00190  Oxidative phosphorylation
dre01100  Metabolic pathways
dre01200  Carbon metabolism
Module
dre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dre_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    562149 (sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    562149 (sdhb)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     562149 (sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 562149
NCBI-ProteinID: NP_001092210
ZFIN: ZDB-GENE-030131-8005
Ensembl: ENSDARG00000075768
UniProt: A5PL98
LinkDB All DBs
Position
22
AA seq 280 aa AA seqDB search
MAAVCFSLSRCCSAVHRPAVTAVRFAQTAAAPAAQPRIKKFQIYRWDPDTVGDKPRMQTY
EIDLNTCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACLNKIDTNT
SKVTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESQQGKQQYLQSVEDRQKLD
GLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWMIDSRDDFTEDRLSKLQDPFSLY
RCHTIMNCTRTCPKGLNPGKAIAEIKKMMVTYKQKDAVAA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtgtgtttctccttgagccgctgctgctctgctgttcaccggcccgccgtc
acggcggtgcggttcgcgcagacagcagcagctcctgcagctcagcccaggatcaagaag
ttccagatttatcgctgggatccagacacagtcggagacaaacctcgcatgcagacatac
gagatcgacctgaacacgtgtgggccgatggttctggacgcactcatcaagatcaagaat
gagatggacagcacactgaccttccggcgctcctgcagagagggcatctgtggctcgtgt
gctatgaacatcaacggtggaaacacattggcgtgtttgaataagatcgacaccaacacc
agcaaggtgaccaagatctacccgctgccgcacatgtatgtggtgaaggacctggtgccc
gacatgagcaacttctacgcccagtataaatccatcgagccctacctgaagaagaaggac
gagtcccagcaggggaagcagcagtacctgcagagcgtggaggaccgccagaaactggac
ggcctgtacgagtgtatcctgtgcgcctgctgcagcaccagctgtccgagttactggtgg
aacgcagacaagtatctgggtccagccgtcctcatgcaggcgtaccgctggatgatcgac
tctcgggatgatttcactgaggacagactgtccaagctgcaggacccgttctctctgtac
cgctgccacaccatcatgaactgcaccaggacctgccccaaggggctgaatccaggaaaa
gccatcgctgagatcaagaagatgatggtgacgtataagcagaaggacgcggtggcggcg
taa

DBGET integrated database retrieval system