KEGG   Danio rerio (zebrafish): 562739Help
Entry
562739            CDS       T01004                                 

Gene name
galnt14
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 14
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    562739 (galnt14)
   00514 Other types of O-glycan biosynthesis
    562739 (galnt14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    562739 (galnt14)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     562739 (galnt14)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   562739 (galnt14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 562739
NCBI-ProteinID: NP_001038460
ZFIN: ZDB-GENE-041014-351
Ensembl: ENSDARG00000023448
Vega: OTTDARG00000006059
UniProt: Q5RFV2
LinkDB All DBs
Position
20
AA seq 554 aa AA seqDB search
MKRLSRKLTLALAALFWIAALLYFILLNSRKILPDQRNEQPQVKEISDTEWDDLLEEFEE
KSYLSAHRWKPGQDPYSLYAFNQRESERIPSNRALRDTRHYRCTTLHYDPDLPSTTIVIT
FHNEARSTLLRTVRSVLNRTPVHLIHEIILVDDFSEDPNDCLLLTKLPKVKCLRNKHREG
LIRSRVRGADAAGAQILTFLDSHCEVNKDWLPPLLQRVKEDPTSVASPVIDIINMDTFAY
VAASSDLRGGFDWSLHFKWEQLSAEKRAKRADPTEPIKTPIIAGGLFVIDRSWFNRLGKY
DTAMDIWGGENFEISFRVWMCGGSLEIIPCSRVGHVFRKKHPYIFPEGNANTYIKNTRRT
AEVWMDEFKLFYYSARPAARGKSYGDIHGRQELRKSLNCKSFKWYLDNVYPELKVPDDSD
AKSGVIRQRQNCLESRVVEGQDLPVLTLAPCIITKETPAANQEWIYTHGQQIRQQQYCLS
VSTTFPASQILLMPCNISDGKQRWQKSGTHLEHLASRFCVDSEMALDGIESSKMLVISPC
ELSAHTQRWEMPFS
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggctttctcgaaagctgactttagctctggcagcgctcttttggatagcagct
ttactctatttcatactgctgaacagccggaaaatactacctgaccaaagaaacgagcaa
ccgcaagtcaaagagatctcagatactgagtgggatgacctgctggaagagtttgaagag
aaaagctacctcagtgctcacagatggaaaccgggccaggacccatacagtctgtatgcc
ttcaatcaaagagagagcgaacgaatccccagcaacagagcacttagagacacccgacat
tacaggtgtacaacactgcactatgaccctgatctgccatccaccaccatagtgatcacg
ttccacaatgaggcgcgatccaccctactgcgcacagttagaagtgtgttgaatcggacg
cctgtgcatcttattcatgaaatcatattggtggatgacttcagtgaagatccaaacgat
tgccttcttctcaccaagttgcccaaagttaagtgtcttcgcaataaacatagagaagga
ttgatccgctctcgtgttcgaggggctgacgctgcaggagcccagatcctgacttttttg
gacagtcactgtgaggtcaacaaagattggctgcctccactgctgcagagggtcaaagag
gacccgacctctgtcgccagccccgtgattgacatcattaatatggacacgtttgcctac
gtcgctgcttcctcagacttgcgaggaggattcgactggagtttacactttaaatgggag
caactatcagctgaaaagcgagccaagagagctgaccctacagagcccattaaaacgccc
atcatcgcaggaggacttttcgtgattgacagatcctggttcaatcgcttggggaaatat
gacaccgccatggacatctggggaggggagaatttcgaaatctcgttcagagtatggatg
tgtggaggaagcctggaaattatcccctgtagcagggtcggccacgttttccgcaagaaa
catccttacatcttcccagagggcaatgctaacacctacataaagaacaccagaaggacc
gctgaggtttggatggatgagttcaaactgttctactactcggctcgaccagctgccagg
ggaaaatcctatggagacattcacggcaggcaggagctccgcaagagtctcaactgcaaa
tccttcaagtggtatctggacaacgtctatccggagctcaaagtacctgatgattctgat
gccaagtctggtgtgatccggcagagacagaactgtctagagtctcgagtagtcgaaggc
caggatctcccagtgctcacactcgcaccctgcatcatcaccaaagagacaccagcagcc
aatcaggagtggatctacacccacggacagcaaatccgccagcagcagtactgtctgtcc
gtctccaccactttccctgcctcccagatcctactcatgccgtgcaacatcagcgacggc
aagcagcgctggcagaaatctggcactcacctggagcacctggcgtctcgtttctgtgtg
gacagtgagatggctctggatggcatcgagagcagtaaaatgctggtgatcagcccgtgc
gagctgtcggcacacacacagagatgggaaatgcctttctcgtga

DBGET integrated database retrieval system