KEGG   Danio rerio (zebrafish): 563654
Entry
563654            CDS       T01004                                 

Gene name
nos2b
Definition
(RefSeq) nitric oxide synthase 2b, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00220  Arginine biosynthesis
dre00330  Arginine and proline metabolism
dre01100  Metabolic pathways
dre04020  Calcium signaling pathway
dre04146  Peroxisome
dre04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    563654 (nos2b)
   00330 Arginine and proline metabolism
    563654 (nos2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    563654 (nos2b)
   04020 Calcium signaling pathway
    563654 (nos2b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    563654 (nos2b)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     563654 (nos2b)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 563654
NCBI-ProteinID: NP_001106973
ZFIN: ZDB-GENE-080916-1
Ensembl: ENSDARG00000031976
Vega: OTTDARG00000035871
UniProt: A9JNR5
LinkDB
Position
15
AA seq 1077 aa
MGNQVTHKSELLQQMKPDMQWENKVKQCPFSKQLKNYQDSSCHQDVLHHRAVKSHICSSK
ICEGSIMTPKSLTRCPMTTLHCPDDILVQAVDFINQYYKSVKNSKIEEHLSRVEEVAMEI
DATGSYQLTTKELEFGAKQAWRNAPRCIGRIQWANLQLFDARKCQTAEDMFQMLCDHIQF
ATNGGNLRSAITVFPQRADGQHDFRVWNSQLIRYAGYKMTDGTILGDPASVDFTEICIQL
GWTPKYGLFDVLPLLLQANGEDPQLFEIPKDLILEVPMEHPQYEWFEDLNLRWYALPAVS
NMLLEIGGLEFPACPFNGWYMGTEIGVRNFCDTQRYSVLEHVGRQMSLETQNLSSLWKDQ
ALVAINVAVMHSYQKNKVTITDHHSASESFMQYMEMEVRLRGGCPADWVWLVPPMSGSLT
PVFHQEMLNYILSPFFYYQPEAWLTHKWKDMKRKARRCTISFKGLIRVVLFSQVLIKLAM
AKRVCCTVLYATETGKSQTFAKKLNGIMNCCFSSRVVCMEDYNVSELEKESLLIVVTSTL
GNGDCPGNGESFKKQLLSLKTLRNKVRYCVFGLGSRMYPHFCAFAHALDAMFATLGAIRV
SSTGEGDELKGQEESFSSWACTAFKDACKEFNVQGQLPGTDCLVDSWDSQRYRVQNDSCT
VDRITALSTLHSKAVVPMKLKRRQNLQSAKSSCATILVELEMEGNTEPLNFTPGDHVGIF
AGNSPGLVAGILKRLPNANPINQSLQLEFLSAHADGERWQRDERIPPCSFAQALTYYLDV
TSPPSQSLLRKLSKIARQEDHRQHLLALASDFQVYTTWKDFFKPTFLEVLEEFPSLELPA
AFPLSQLPLLKPRLYSISSSPDLHPQELHLTVAVISYYTQEGKGPLHFGLCSNWLNTIKE
GDTVPCFLHSSDWFHLPSDPNAPCILVGVGSGIAPFRSFWQQQFHDMNKTGLKGNPMTLV
FGCRSSDTDHLYKEEILDMRDNGTLSSITTAYSRQTGQAKVYVQDILREQLNDKIFEVLH
HNSGHVYVCGGVNMACDVAATVKEILVNQMGITVAQAEEYLSRLKNEKRYHEDIFGY
NT seq 3234 nt   +upstreamnt  +downstreamnt
atgggcaaccaggtcactcacaagagcgaactactgcagcagatgaaaccggatatgcaa
tgggagaataaagtcaagcagtgcccattttctaagcaattaaagaactatcaggatagt
tcgtgccatcaagatgtgttacatcacagggcagttaagagccatatttgttcgtctaag
atttgtgaagggtcaatcatgactccaaaatctttgacgcgctgtcccatgaccactttg
cattgtcctgatgacatcctcgtgcaagctgttgacttcatcaatcaatactacaagtca
gttaaaaactcaaagattgaggaacacttgtctcgtgtggaggaagttgcaatggaaata
gatgctactggatcatatcaactcaccacaaaagagctggaattcggggctaaacaagca
tggaggaatgctccaagatgcattggcagaattcaatgggctaatttgcagttgtttgat
gcgcgtaaatgccaaactgctgaggacatgtttcagatgttatgcgatcatattcagttt
gctaccaatggaggcaacctgaggtctgccatcactgtgtttcctcaaagagctgatggc
cagcatgatttccgtgtgtggaatagtcagctcatacgatacgctggctataagatgaca
gacggcacaatattaggagatcctgccagtgttgacttcactgagatttgtatccagctt
ggttggactccaaagtacggtctatttgatgtacttccactgctgttacaagctaatgga
gaggacccccagctttttgaaattcccaaagatttgattttggaagttcccatggagcac
ccacagtatgagtggtttgaggatttgaacctgcgttggtatgcattgcctgcggtgtcc
aacatgttgctggagattggtggtcttgaattcccagcatgtccttttaacggttggtac
atgggcactgagattggagtgaggaacttctgtgatacccagcgctacagtgttcttgag
cacgttggccgtcagatgagcttggagactcaaaatctgtcctcgctatggaaggaccag
gctctggtggccattaatgtagcagtcatgcatagttatcagaaaaataaagtcaccatt
actgaccaccattctgcatcagagtccttcatgcagtacatggagatggaggtgcgtctg
cgtggaggatgtccagccgactgggtttggctggtgccgcctatgtctggatctctgact
ccagtctttcaccaggaaatgctgaactacatcctctcaccctttttctactaccagcct
gaagcctggttgacgcacaagtggaaggacatgaagagaaaagcgaggcgctgtacaatc
agctttaaaggactgatcagagtagttctcttctcacaagtacttattaagttggctatg
gccaagagagtgtgttgtacagttctctatgccacagaaactggaaaatcgcagactttc
gctaagaaactaaacggcatcatgaactgttgcttcagctccagggttgtttgcatggag
gactacaatgtaagtgaacttgagaaggaaagcctcctaattgttgttactagcaccctt
ggcaatggcgactgtccaggaaacggtgagagtttcaaaaagcagcttctcagcctaaaa
accctcagaaacaaagtcaggtactgtgtgtttggtcttggctctcggatgtatccacac
ttctgtgcatttgcccatgctctggatgctatgtttgcaacactgggagccatccgtgtt
tccagtacaggagagggagatgagctgaaaggacaggaggaatcgttctcatcctgggct
tgcactgcctttaaggatgcatgcaaggagtttaatgttcaagggcaacttccaggaact
gattgtctggtggattcctgggattcgcagagatacagagttcagaatgacagctgtaca
gttgaccgaatcactgctctgtcgactcttcattctaaagctgtggttcccatgaaactg
aagagaaggcagaacctgcagagtgcaaagtcaagttgtgctacaatattggtggagctg
gaaatggaaggaaacacagagcccttaaacttcaccccaggagaccatgtggggattttc
gcagggaactcacctggattagtggctggcatcttaaagcgtctgcccaatgccaatcct
atcaaccagagccttcagctggaattcctcagtgcccatgctgatggtgaaaggtggcag
agagatgaacgaataccgccatgctcttttgcccaggctctcacctactatctggacgtc
acaagcccaccctctcaaagcctcctccgcaaactctccaagatagccagacaggaggat
cacagacagcacttgctcgctctggcatcagactttcaggtctacacaacatggaaggat
ttcttcaagccgactttccttgaggtgctggaggagtttccctctctggaacttcctgct
gcttttcctctcagtcagctgcctctgctgaagccccgactctactccatcagctcctct
cctgacctccaccctcaggagctccaccttactgttgctgtaattagttattatacacag
gagggaaaaggtccacttcattttggtctgtgcagtaactggctcaacaccatcaaagaa
ggagacacggtgccatgctttctccatagctctgactggttccatcttccgtcggaccct
aacgctccatgtattctagtgggagttggcagcggcattgctcccttccgtagcttttgg
caacagcaattccatgacatgaataaaacaggtttgaaaggcaatccgatgacacttgtg
tttgggtgtcgaagttcagatactgatcatctgtacaaagaagagattctggacatgaga
gacaatggtactctaagcagcatcacaacagcgtactctaggcagactggacaagctaag
gtttatgtccaagatatcttgcgagagcaattaaatgacaagatttttgaggttctgcac
cacaactcaggacatgtgtacgtctgtggaggggtgaacatggcctgcgatgtagctgct
actgtcaaggagatcctagtcaatcagatgggcatcactgttgctcaggctgaggagtat
ctgtcaaggctcaagaatgaaaaacggtaccatgaggacatcttcggatactag

DBGET integrated database retrieval system