KEGG   Danio rerio (zebrafish): 563878Help
Entry
563878            CDS       T01004                                 

Gene name
pomt2
Definition
(RefSeq) protein O-mannosyl-transferase 2
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
dre00515  Mannose type O-glycan biosynthesis
dre01100  Metabolic pathways
Module
dre_M00872  O-glycan biosynthesis, mannose type (core M3)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    563878 (pomt2)
   00514 Other types of O-glycan biosynthesis
    563878 (pomt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    563878 (pomt2)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     563878 (pomt2)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  O-linked Man type
   563878 (pomt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT PMT_4TMC MIR
Motif
Other DBs
NCBI-GeneID: 563878
NCBI-ProteinID: NP_001038498
ZFIN: ZDB-GENE-070112-1002
Ensembl: ENSDARG00000055027
Vega: OTTDARG00000028649
UniProt: F1Q8R9
LinkDB All DBs
Position
17
AA seq 756 aa AA seqDB search
MDVRPKENFSQRQDTSAVRHRKTCKVNERAEIPSQPHNGTINGVNKRITKREGGERISSP
SRDAHVPVFILALVIVLSVSTRFYKITEPPHVCWDETHFGKMGSYYINRTFFFDVHPPLG
KMLIGLAGYLTGYDGTFPFIKPGDKYEHHNYWGMRAFCAALGSCLPPFAFLVVLELSQSS
TAALIAASLLIFDTGCITLSQYILLDPILMFFIMGSVLCMVKFNTQRLGPFSFSWWFWLL
LTGLCLSGSLGVKFVGLFVILLVGINTALDLWRLLGDLSLSLVDFGKHLLARVFGLIMLP
LFLYTTIFAIHFIVLNRSGPGDGFFSSAFQSRLIGNNPHNASMPEYLAYGSVITVKNLRI
AGGYLHSHWHLYPEGVGAHQQQVTAYLHKDYNNLWLVKRLDNSDDLTGSPELVRHGDIIR
LEHKETTRNLHSHFHEAPLTKKHLQVTGYGINGSGDVNDLWQVEVCGGRKGDPVKVLRSK
VRFLHRATGCVLCSSGKTLPKWGWEQVEVTCSPYVKETPNSQWNIEDHINPKLPNISLAV
LKPTFLEILWESHIVMIRGNSGLKPKDNEMSSKPWHWPINYQGLRFSGVNETEYRVYLLG
NPVIWWLNLLSLALFVILLTVASLAVQRRVKMEGMMKVHCHTLMEGGGMLFLGWLLHYLP
FYIMGRILYYHHYFPAMMFSSMLTGITLDILLQNLQLLFSSSLSHYLMRGGQSVLLLGFI
YSFYLFHPLSYGMRGPLAHDSASSMAGLRWMESWEF
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcagaccgaaggagaatttctctcaaagacaagacacatccgctgtaagacat
cgaaaaacatgtaaggtaaacgagagggctgagattccttcccagcctcacaatgggact
attaatggtgtaaataagaggatcaccaaacgagaaggaggagaacgcatcagttcaccc
agcagagatgctcatgtgcccgtttttattttggctctggtgatagtgttgtctgtatct
acacgcttttacaagatcactgagcctcctcatgtatgttgggatgagactcattttggg
aaaatgggaagctattacattaatcgcaccttcttctttgatgtccatccgccccttgga
aagatgctgatcggcctcgctggatacttgacaggttacgatgggacctttcccttcata
aagccaggggacaaatatgagcaccacaattactgggggatgagagcgttctgtgctgct
cttggttcctgtttgcctccttttgcctttcttgttgtcctggagctctctcagtcttca
acagcagcgctcatcgcagcctctctgctcatcttcgacactggttgcatcaccctgtct
cagtatatcctgctggatcccattctgatgtttttcatcatgggctcggttctgtgcatg
gtcaaattcaacacgcaaagactcgggcctttcagcttctcctggtggttctggctgctt
ctgacagggctatgcctctctgggtctcttggtgtaaagtttgtggggctgtttgtcatt
ctcttggttggaatcaacacagcgcttgatctttggagactgcttggggacctcagctta
tctctggtggattttgggaagcacttactagctcgagtttttgggttgataatgcttccg
ttgttcttgtacacgacaatattcgccattcatttcattgtcttaaacaggagtggtccc
ggagatggtttcttcagctctgcgtttcagtctcgcttgattggaaacaatccacacaac
gcctccatgccagagtatctggcatatggctcagtcataacagttaaaaatctgcgaatt
gcaggaggatatttgcactctcactggcacctttacccggagggggttggagctcaccag
cagcaggttactgcctatttacacaaagattataacaacctgtggttggtcaagagactt
gacaactctgacgatctcacaggctcaccagagctcgtccgtcatggtgacatcattaga
ctggagcataaagaaactacaagaaatcttcatagtcatttccatgaagcgcccctgacc
aaaaaacacctgcaggtcacaggttatggcattaatggaagtggtgacgtgaatgacctg
tggcaggtggaggtgtgtggaggaaggaagggagatccagtgaaggtgctgcgcagtaaa
gtgcgttttcttcatcgcgccacaggctgtgtgctctgctcctctggaaagacccttccc
aaatggggatgggagcaagtggaggtcacatgcagcccgtatgtcaaagagaccccaaat
tcgcagtggaacattgaggaccacatcaaccctaaactgcccaacatcagtcttgcagta
ctcaaacccactttcctggagatcctctgggagtctcatattgtgatgatcaggggaaac
agtggtttgaagcccaaagacaacgagatgagctctaaaccctggcactggcccattaac
tatcagggattaaggttttctggagtgaatgaaactgaataccgtgtttatctccttgga
aaccctgtcatttggtggctgaacttgttaagtctggctctatttgtaatcctgctgacg
gtggcttcattagccgtgcagagaagagtgaagatggagggaatgatgaaagtgcattgt
cacacacttatggagggtggcgggatgctgtttttgggttggctgttacactatctccca
ttctacatcatgggtcgcatactctactaccatcattactttcctgccatgatgttcagc
agtatgctaacaggtattactctggacatcctccttcagaatttgcagcttctctttagc
tcatctttatctcattacctgatgaggggaggtcagtcggtgctcctcttagggtttatc
tacagcttttatcttttccaccctctctcctatggcatgagagggccgctggcacatgac
tctgcctcctccatggccggtctcaggtggatggaatcctgggagttttag

KEGG   Danio rerio (zebrafish): 569769Help
Entry
569769            CDS       T01004                                 

Gene name
pomt1
Definition
(RefSeq) protein O-mannosyl-transferase 1
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
dre00515  Mannose type O-glycan biosynthesis
dre01100  Metabolic pathways
Module
dre_M00872  O-glycan biosynthesis, mannose type (core M3)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    569769 (pomt1)
   00514 Other types of O-glycan biosynthesis
    569769 (pomt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    569769 (pomt1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     569769 (pomt1)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  O-linked Man type
   569769 (pomt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT PMT_4TMC MIR
Motif
Other DBs
NCBI-GeneID: 569769
NCBI-ProteinID: NP_001041532
ZFIN: ZDB-GENE-060929-966
Ensembl: ENSDARG00000067670
Vega: OTTDARG00000035303
UniProt: F1QF89
LinkDB All DBs
Position
5
AA seq 720 aa AA seqDB search
MQCVKLPVSVTVEINVLLLAVTALALFTRLYGIHFPKAVVFDEVYYGQFLSLYMKQVFFI
DESGPPFGHMILALGAYLGGFDGNFVWNRIGAEYPGNVPVWSLRLIPALAGSFCVPLAYL
VVVELGYSHFSALGACALLLMEDSLIVQSRFMLLESVLIFFLLLAVLSYLRFHKARNSSF
KWFWLVICGVSCAFGIGVKYMGMFTYFLLLSQAAVHTWQLIGDRTLSHGKVMFHVLVRFL
ALVVLPVIMYLGFFYIHLTLLYRSGPHDQMMSSAFQASLEGGLARITQGQPLDVAFGSQV
TLRTVSGKPVPCWLHSHKANYPIRYENGRGSSHQQQVTCYPFKDVNNWWIIKDPGRQSLV
VSSPPRPVRRGDIIQLLHGMTTRYLNTHDVAAPMSPHSQEVSGYIDFNVSMPAQNLWRVD
IVNRESEKEIWKTILSEVRLVHVNTSAVLKLSGASLPEWGFKQLEVVGDKIYKGYQQTGM
WNVEEHRYGRSQEPKERELELKSPTHSDVNKNLTFMAKFLELQWKMLTVKNEESEHKYSS
SPLEWITMDTNIAYWLHPSSNAQIHFIGNIVTWTTGNITLVVYCLLFLTYLIRRRRKVED
IPQDSWEQLVLAGVVCFGGWAVNYLPFFLMEKTLFLYHYLPALTFKILQIPIVTEHLYIH
VLRSSAQQKAFGGVILAVLCSVYMSYHSLSPLTYGQPALTSDKLAELRWRESWDILLRKR
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgtgttaaactgcccgtcagtgtgacagtggagataaatgtgctgctgctggcg
gttacagcacttgccctctttactcgactttatggcattcactttcccaaagctgtagtg
tttgatgaggtttattatggacagttcctgtcattgtacatgaagcaggtttttttcata
gatgaaagcggtcctccttttggacacatgatacttgctttaggagcgtatttaggagga
tttgatggcaactttgtttggaacagaattggagcagaataccctggtaatgtccctgtt
tggagccttcgactgataccggctctggcaggctctttttgtgtgccacttgcatatctt
gtagtagtggagctgggatactctcacttctcggcactgggggcctgtgcgcttctcctc
atggaagactccctgattgtgcaatcgcgcttcatgctgctggagtctgttttaattttc
ttcttgctgttggctgtgctgtcttacctccgctttcacaaagcacgcaactcatctttc
aagtggttttggcttgtgatctgtggggtcagctgtgcatttggaattggagtaaagtac
atgggtatgttcacatactttctactgctgagccaggcagctgtacacacctggcagctt
attggagatcgaaccttgagccatggcaaagtaatgttccacgtattggttcgcttcctg
gcactcgtggtgctacctgtcatcatgtaccttgggtttttctacattcatctgaccttg
ctatatcgcagtggacctcatgaccagatgatgagcagtgcctttcaagcaagtctcgag
ggtggtcttgcccggatcactcaggggcagcctttagatgtagcatttggctcacaggtc
actctccgcacagtctccggtaaacctgtgccttgttggcttcactcacacaaggccaac
tatcccatcaggtatgaaaatggccgtggaagctcccaccagcagcaggtgacctgctat
cctttcaaagatgtcaacaactggtggattatcaaagaccctgggcggcaaagtcttgtg
gtcagcagcccacccagacctgtcagacgtggggatattattcagttgctgcatggaatg
acaactcgctacctgaacacacatgatgttgcagcccccatgagtcctcactcacaggaa
gtgtcgggctatattgattttaacgtgtctatgccagctcagaatctctggagagtggat
attgtgaacagggagtctgagaaagagatctggaagaccattttatcagaggtgcgacta
gtccacgtgaacacctcagctgttttaaagctcagtggagcctctctgccagagtggggt
tttaaacagctggaggtggtgggtgataagatttataaaggctaccagcagaccggcatg
tggaacgtggaggagcaccgctatggcagaagtcaggaaccaaaggaaagggagttggag
ctgaagtctcctactcacagcgatgtcaacaaaaatctcacatttatggccaaatttctg
gaactgcagtggaagatgctgacagtaaagaacgaagagtcagagcacaaatatagttca
tcacctcttgaatggatcacaatggacaccaacattgcatattggcttcatccttcaagt
aatgcacagattcactttataggcaatattgttacttggaccactggaaacattacactg
gttgtgtactgtcttctgtttttaacatacttaataagacggaggaggaaagttgaagac
attccacaagactcttgggaacagttggttttggctggtgtggtttgctttggaggctgg
gcagtgaattacctgccattcttcctaatggagaagactctctttctatatcactatctc
ccagcactcaccttcaagatcttgcaaatacctatagtcacagagcacctgtacatccac
gtattgagatcctcagctcaacagaaagcatttggtggtgtgattttagcagttctttgt
tcagtatacatgtcctaccacagcttgagtcctctcacgtatggccagccagcgttaaca
tcagacaagctcgctgagctgcgctggagggagagttgggatattctcttacgcaaacgc
taa

DBGET integrated database retrieval system