KEGG   Danio rerio (zebrafish): 564156Help
Entry
564156            CDS       T01004                                 

Gene name
b3glctb
Definition
(RefSeq) beta-1,3-glucosyltransferase precursor
  KO
K13675  UDP-glucose:O-linked fucose beta-1,3-glucosyltransferase [EC:2.4.1.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    564156 (b3glctb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    564156 (b3glctb)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     564156 (b3glctb)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  O-Glycan
   564156 (b3glctb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Glyco_transf_21 DUF604 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 564156
NCBI-ProteinID: NP_001289177
ZFIN: ZDB-GENE-091204-128
Ensembl: ENSDARG00000077740
Vega: OTTDARG00000031140
UniProt: A0A068F5P3
LinkDB All DBs
Position
10
AA seq 493 aa AA seqDB search
MSRYTAGHNVIYFCCSLLSFVPSCNALNDDSCEKPPRSGAEMYGRHIELRDVLFVIQSQR
NSYHTQRAEQRRKEILHQAQTVTQSSPDVVLLHKLSHYDGNWSILPALPRLALQYCQTSL
WIMFLQEETIVNLHNLLQVLSRFSPGKEWFLGRSLHDDEPTIIHHYAFSEDPYSFAYPDF
MAGWAISCPLAKRTAERVNYEPPKSDFTIDLQHEIALYIWEEGRGPTLTAVNEFCSELHG
SSSAKCCATAVNTYLSACGKPVLKEDVFVAVKTCQRFHRDRVPIVKQTWEKDAASLEYYS
DVTDSIIPTVHLGVPNTERGHCEKTFAILRRFASGAVTQAPWLLIVDDDTLISLPRLRRL
LSCYDPTEAVSVGERYGYGLSRDGYSYITGGGGMVFSRVAVQNILAGGCSCRSSDAPDDM
VLGMCLTTLGLPVTHSPLFHQARPDDYVKELLARQSPISFHKHWNIKPVAVYQRWLSEPD
QRPHWLTDTREEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtctagatacactgctggacacaatgtcatatatttctgctgctccctactctccttt
gtgccttcttgcaatgctttaaacgacgatagctgtgaaaaacctccaagaagtggcgca
gaaatgtatggccgacatattgaactgcgggatgtgttatttgtgatacagagtcagaga
aactcatatcacacccagagggccgaacaaagaagaaaagaaattctccatcaggctcag
actgtaacccagagttcaccagatgttgtgctccttcacaagctgtcacactatgatgga
aactggagcattcttccggcactgccacgccttgccttgcagtactgtcaaacatctttg
tggattatgttcttgcaagaagagactatcgtgaacttgcacaaccttctgcaggtgctg
agcagattcagcccaggaaaggagtggtttctgggcagatccctccatgatgatgaacca
acaatcatccaccactatgctttctcagaagacccctacagcttcgcttaccctgacttc
atggctggctgggccatcagctgccccttggctaagcgaactgcagaacgtgtgaattat
gagcctcccaaatcggattttacgattgaccttcaacatgagattgccctctacatttgg
gaggaagggagaggtcctactttgactgcagtgaatgagttttgttcagagcttcacggc
tcgtcctccgcaaaatgctgtgctacagccgtcaacacctacttatcggcttgtggaaaa
cctgtgctgaaggaggacgtctttgttgctgttaaaacatgccaaagatttcacagagat
agagttcctatagttaaacagacatgggaaaaagatgctgcctcgctggaatactacagt
gacgtcacagactcaattatccccacagtccacttgggagtccctaacacagagagaggg
cactgtgaaaaaacatttgccatcctgagaaggtttgccagtggagcagtaacacaagca
ccatggctgcttatagtggatgacgacacactgatcagtctgcccagactgcggaggctt
ctgagctgttatgatccaactgaagctgtgagtgttggagaacgttacggctatgggctt
agcagggatggctacagctacatcacaggaggtggagggatggtgttcagtagagtcgct
gttcagaatattctggcaggtggttgcagctgccgcagttcagacgcccctgatgatatg
gtgttagggatgtgtctgaccacattggggctcccagtcacacacagcccacttttccat
caggcccgtccagatgattatgtgaaagagcttctggcacggcagagtccaatctccttc
cacaaacactggaacatcaagcctgtggccgtttaccagcgctggctttcagagcctgac
cagagaccacactggctcacagacaccagagaggagctgtag

KEGG   Danio rerio (zebrafish): 799443Help
Entry
799443            CDS       T01004                                 

Gene name
b3glcta
Definition
(RefSeq) beta-1,3-glucosyltransferase
  KO
K13675  UDP-glucose:O-linked fucose beta-1,3-glucosyltransferase [EC:2.4.1.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    799443 (b3glcta)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    799443 (b3glcta)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     799443 (b3glcta)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  O-Glycan
   799443 (b3glcta)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T Glycos_transf_2 Glyco_transf_21 DUF604
Motif
Other DBs
NCBI-GeneID: 799443
NCBI-ProteinID: NP_001289180
ZFIN: ZDB-GENE-110411-147
Ensembl: ENSDARG00000073917
UniProt: A0A068F9P7
LinkDB All DBs
Position
15
AA seq 496 aa AA seqDB search
MLSIKCQNGYSVTQYFFLWSLVAFITAKGDEVENPAKVHGTDKPSSGSQLDLREVVFVIQ
SQRNSFHVRQAEKLRKDLLLQTQTLQESPPVILLLHTLSDNEGDWSILPLLPRLSSQFGK
NSSWIMFLEEDTRVKLQKLHEVLKKFDRRKEWFLGKPLHDEESTIIHHYAFSENPTAFEY
PDFSAGWALSIPLINRLASKIEEEPLKSDFTIDLKHEVALYIWEDGKGPRLTGVPELCTL
AEHNKRAQSCATTVSSHSPLCGEPVKIENIFVAVKTCKKFHSDRVPVVKKTWGKQASLLE
YYSDYADPSIPTINLGVPNTERGHCGKTFAILRRFLSSHVPRTDWLLIVDDDTLISLPRL
QALLSCYESSEPLCLGERYGYGLGQGGYSYITGGGGMLFSREAVVQLLSSGCNCYSNDAP
DDMVLGMCLNSLRVPVTHSPLFHQARPEDYARDFLSHQTPISFHKHWNIDPIAVFNKWLK
NEKHTEGLQKSTKEEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgctctccataaagtgtcaaaacggatacagtgtaacccagtatttcttcctttggtct
cttgtggccttcattactgcgaaaggagatgaagtggagaatcctgcaaaggttcatggc
actgacaaaccttcttctgggagtcaactcgacttgagagaagtggtgtttgtcatccag
agccagaggaactctttccatgtgcggcaggcggagaaactcagaaaagaccttctgctg
cagacacaaactctacaggagagtcctcctgtcatcctgctcctgcatacgctgtcagac
aatgaaggagactggagcattctccctctgctgcctcgcttgtcgtcacagtttggcaag
aactcatcttggatcatgtttctggaggaggacacaagagtaaaacttcaaaaacttcac
gaagtactcaaaaaatttgaccgcagaaaagagtggtttcttggcaaaccactacatgat
gaagagtccaccatcatccatcattatgccttctcagagaaccccaccgctttcgagtac
ccagacttctctgcaggatgggctctcagcatccctctcatcaacaggttggcaagcaaa
attgaagaagagcctttaaagtcggacttcactatagatctaaaacatgaggtggcactg
tatatctgggaggatggcaaaggacctcgactgacaggcgtccctgaactttgcacgctt
gcagagcacaataaaagagctcagtcctgtgccaccactgtcagcagccattcaccactg
tgtggtgagcctgtgaagatcgaaaacatcttcgtagcagtgaaaacttgcaagaaattc
cattctgacagagttcccgtggtgaagaaaacatggggtaaacaagcctctctgctggag
tattacagcgattacgctgatccctccataccaaccattaatctgggagtgccaaacaca
gagagaggtcactgtggaaaaacatttgccatcttgaggcggtttttgagcagtcacgtg
cccagaactgactggctgttgattgtggatgatgatactctaataagcttgcccagactg
caggccttgctgagctgctatgagtccagtgagccgctgtgtctgggagagcggtatggt
tatggactgggtcagggaggatacagttacatcactggtggtggagggatgttattcagt
cgagaggctgtggtccagctgttgtccagcggctgtaactgctacagtaatgatgctcct
gatgatatggtgttgggcatgtgtctcaattctctcagagtccctgtcacacacagtcca
ctcttccaccaggctcgtccggaggattacgcgagggactttttatcccaccagaccccg
atttccttccacaaacactggaatatagaccctatagcggtgtttaacaagtggctgaag
aacgaaaaacatacagaaggactacagaaaagcactaaggaggaattatag

DBGET integrated database retrieval system