KEGG   Danio rerio (zebrafish): 564523Help
Entry
564523            CDS       T01004                                 

Gene name
sgk3
Definition
(RefSeq) serine/threonine-protein kinase Sgk3
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    564523 (sgk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    564523 (sgk3)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     564523 (sgk3)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   564523 (sgk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PX Pkinase_C Kinase-like FTA2 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 564523
NCBI-ProteinID: NP_001103937
ZFIN: ZDB-GENE-070424-62
Ensembl: ENSDARG00000062460
Vega: OTTDARG00000028709
UniProt: A4IG56
LinkDB All DBs
Position
24
AA seq 486 aa AA seqDB search
MEEQPSCPNVSIPCYNEQRDKKKRYTVYKVMVSVGRHEWFVFRRYAEFDKLYNTLKKQFP
ALNLKIPAKRIFGDNFDPEFIKQRRAGLHEFIQRIVSHSQLCSHPDVKVFLQMDKAKNFS
DGSEDEDDKSNSTSRNINLGPSANPHAKPTDFDFLKVIGKGSFGKVLLAKRKRDGKCYAI
KVLQKKVILNRREQKHIMAERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDFVNGGELFF
HLQKERTFPEPRAKFYIAEMASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKE
GISQADTTTTFCGTPEYLAPEVLRKQPYDNTVDWWCLGSVLYEMLYGLPPFYSRDTHEMY
DNILHKELVMRPGASTAAWSILQTLLEKDHTRRLGYRDDFNEVKEHEFFSSINWYDLEQK
KLPPPFNPSVESQYDISNFDPEFTEETVPNSVCFSSGPSIVNASVMEADDAFLGFSYAPP
SEDSFL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcaacctagctgtcccaatgttagcattccatgctataatgagcagagggac
aagaagaaacgctatactgtttacaaagttatggtcagtgttggaaggcatgagtggttt
gtgttccggagatatgcagaatttgacaaattgtacaacacgttgaaaaaacaatttcct
gcgctgaatttgaagattcctgctaagagaatatttggcgacaattttgacccagagttt
ataaaacagagacgagcggggttacatgagttcattcagaggatcgtgtcccattcacag
ctctgcagccatcccgatgtcaaagtctttctgcagatggacaaagccaaaaacttctct
gatggctcagaggatgaagacgacaagagtaactctacctctagaaacattaacctgggg
ccatctgcaaatccacatgcaaagcccactgactttgactttcttaaagtcataggaaag
ggaagctttgggaaggttctccttgcaaagaggaaacgggatgggaagtgttatgccatc
aaagtcttgcaaaaaaaggtcattctaaacaggagagagcaaaagcacatcatggctgag
cgcaatgtgttgctgaagaatgttaaacaccccttcctggttggcctgcactattccttt
cagacaacggacaagctatactttgttctggattttgtcaatggtggagaacttttcttt
catctccaaaaagagcggacctttcctgaacccagagcaaagttttatattgcggagatg
gcgagcgctctgggttacttgcactctcttaacattgtttacagggatttaaaaccagaa
aatatcctgctggactctcaaggccatatagtcttgactgactttggactgtgtaaggag
ggcatctctcaagcagacacaacaaccacattttgtggaacacctgagtatctagctcca
gaagtactcaggaaacaaccctatgataacactgtggactggtggtgtctgggttccgtg
ctgtatgaaatgctttatggactgcctccgttctacagcagggacacgcatgagatgtac
gacaacattcttcacaaggagcttgtcatgcggcccggggcgtccacagctgcgtggtcc
atccttcagaccctgctggagaaagaccacaccaggaggcttggctacagagatgacttt
aatgaagtcaaagaacatgaatttttctcatctattaactggtatgaccttgaacagaaa
aagcttcctcccccatttaaccctagtgtggaatcccagtatgacatctcaaactttgat
cccgagtttacagaggaaaccgtgccaaactctgtgtgcttctcatcagggccgtcgatc
gtcaatgcgagtgtcatggaagcggacgatgcctttctgggattttcttacgctccgcca
tcagaagattctttcttgtaa

DBGET integrated database retrieval system