KEGG   Danio rerio (zebrafish): 564921
Entry
564921            CDS       T01004                                 

Gene name
bada
Definition
(RefSeq) bcl2-associated agonist of cell death isoform X1
  KO
K02158  Bcl-2-antagonist of cell death
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04140  Autophagy - animal
dre04210  Apoptosis
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04910  Insulin signaling pathway
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    564921 (bada)
   04370 VEGF signaling pathway
    564921 (bada)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    564921 (bada)
  09143 Cell growth and death
   04210 Apoptosis
    564921 (bada)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    564921 (bada)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    564921 (bada)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    564921 (bada)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 564921
NCBI-ProteinID: XP_005161421
ZFIN: ZDB-GENE-030131-2378
LinkDB
Position
21
AA seq 145 aa
MENTSHDHQDDSSTLDEKERSHLKGTIKNHGQHQDRTSANISPQGRVRLYSESQVYTVSR
WQDTETQDGASVEENGDGLPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKR
ANSQKQTYRGWFSFLWSPKEEEGRE
NT seq 438 nt   +upstreamnt  +downstreamnt
atggagaacacctcgcatgaccatcaagatgattccagcaccttggatgaaaaagagaga
tcacatctgaaagggacaatcaagaaccatggacaacatcaggatcgaacatcggccaac
atttctcctcaagggcgtgtgcggctctattcggaatctcaagtgtatacagtcagccgc
tggcaggacacagagacccaggatggagcatcggtggaggagaacggagatggacttcca
ttcaggggtcgttctcaatcagcacctgctgcactgtggaaagcaaaaaagtatggccgt
cagttgaggagaatgagcgatgaattcgacacatggctcgataaaggggaggtcaagaga
gcgaacagccagaaacagacctaccgaggatggttttcgttcctctggagtcccaaagaa
gaagagggcagagaatga

KEGG   Danio rerio (zebrafish): 58100
Entry
58100             CDS       T01004                                 

Gene name
badb
Definition
(RefSeq) BCL2 associated agonist of cell death b isoform 1
  KO
K02158  Bcl-2-antagonist of cell death
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04140  Autophagy - animal
dre04210  Apoptosis
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04910  Insulin signaling pathway
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    58100 (badb)
   04370 VEGF signaling pathway
    58100 (badb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    58100 (badb)
  09143 Cell growth and death
   04210 Apoptosis
    58100 (badb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    58100 (badb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    58100 (badb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    58100 (badb)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 58100
NCBI-ProteinID: NP_001257524
ZFIN: ZDB-GENE-000616-1
Ensembl: ENSDARG00000054937
Vega: OTTDARG00000019794
UniProt: Q4V925
LinkDB
Structure
PDB: 
6FBX

Position
7
AA seq 147 aa
MAHMFNISDDSETETMEDSEDSSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEE
DLLETGVAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQLRRMSDEFDKGQMKRVKSAGTA
RQMSQSPSWLAFLWSHKESDAESRPAE
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcacatatgtttaatatctctgatgattcagagacagaaacaatggaagacagtgaa
gactcaagcctggataaacacaagagtgggtcggcacagaaaaagcagcacctcactgtt
cctgataggctgaaaggagagcaactgggcagacagaggaacctctcgatgaatgaggag
gacttgctggaaactggagttgcagaagatcctcatatgcttggggatcctttcaggccg
agatcccgctcagctcctcctgctttgtgggcagctaagaaatacggccaacagctgaga
agaatgagtgatgagtttgataaagggcagatgaagagagtaaaaagtgcaggaactgcg
cgtcagatgagtcaatcgcccagctggttggcatttctttggagtcacaaagagtctgat
gcggagtcgcgccccgcagagtga

DBGET integrated database retrieval system