KEGG   Danio rerio (zebrafish): 567794Help
Entry
567794            CDS       T01004                                 

Gene name
galnt17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    567794 (galnt17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    567794 (galnt17)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     567794 (galnt17)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   567794 (galnt17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 567794
NCBI-ProteinID: XP_696189
ZFIN: ZDB-GENE-110419-5
Ensembl: ENSDARG00000042418
Vega: OTTDARG00000039834
UniProt: E7EZL6
LinkDB All DBs
Position
15
AA seq 617 aa AA seqDB search
MMRFTGFRTPKSFMAFVMRRWKILLVLNVFTVAGFITFWGKCNVRTTKGVGQQMAVDSRG
QTNLNGSVQETSITHDVLLKRLGSLEDVVYRQLNGLSKSLGLIEGFGGRGRGGIPATLTP
AEEKEAKFLREKYGYNAFLSDKISLDRSLPDYRPSKCKKAFFPRDLPQISIIFIFVNEAL
SVILRSVHSAVNHTPAHLLKEIILVDDNSDDVQLKGPLEEYVNKRYPGLIKIVRNQKREG
LIRARIEGWKVATGEVTGFFDAHVEFTPAWAEPVLSRIKENHKRIILPSIDNIKDETFEL
ERYENSGHGYNWELWCMYISPPKQWWDEGDTSAPIRTPAMIGCSFVVNREYFGDLGLLDA
GMDVYGGENIELGIRVWLCGGSMEVLPCSRVAHIARTKKPYHSNIAFHTRRNALRVAEVW
MDQYKSNVYLAWNLPMKNHGIDYGDVSERLALRKRLQCKSFDWYLDNIYPEMRRYNNTVF
YGEIRNTNVTHLCVDQGIKENHTATLHPCHGWGPQLGRYTKEGYLFLGPLGSTGEDTRCV
VDDKISSYPQLLNCEKVSSVRQKTWHFAQNESIISRATGRCLEVVPANVYFGYALILRSC
TGQKWNIKNLMKQDQGQ
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtttcactggattccgaacaccaaaatcgttcatggcctttgtgatgagaaga
tggaaaatattactggtgctgaatgtgtttacggtggccggctttatcactttttggggc
aagtgcaatgtacgcaccaccaaaggtgttggacaacagatggctgtcgattcaagagga
caaaccaatctgaatggatctgttcaggagaccagcatcactcatgatgtgctcttaaag
agactgggatcactggaagatgtggtgtacaggcaacttaatggtttgtccaaatctctt
ggactcatcgaaggttttggaggccggggtagaggaggtataccagccacacttacacca
gcggaagaaaaggaggccaaattcctgagggagaaatatggctataatgcatttctgagt
gacaaaatctctctggatagatcacttccagactaccgtcccagcaaatgcaaaaaggcc
ttttttccccgtgacctgccacagatttccatcatttttatcttcgttaatgaggcgttg
tctgttatactgcgttcagtccattcagctgtcaaccacacaccagcacatcttctaaag
gagatcatcttggtggatgacaacagtgatgatgtgcaactgaaaggcccactggaggag
tacgtcaacaaacgctacccgggtcttatcaaaatagtgcgcaatcagaagagagagggg
ctcatacgggctcgcatcgagggctggaaagtggccactggggaggtgaccggcttcttt
gatgcccatgttgaattcacgcctgcatgggctgaaccagttctgtctagaatcaaggag
aaccacaagaggatcatcttgccctccatagataacatcaaagatgagacgtttgaactg
gaacgctatgagaactcaggccacggctataactgggagctctggtgtatgtatatcagc
ccacccaaacagtggtgggatgaaggggacacttctgcacctatcaggacgcctgcaatg
ataggctgctcttttgtggtaaaccgggaatactttggggatttgggcctactggacgca
gggatggatgtgtatggaggcgaaaatatagagctgggaatcagggtttggttgtgtggg
ggcagcatggaagtcctgccttgttccagagtggctcatattgctcgaacaaagaagccc
taccacagtaacattgcctttcacacaagacgcaatgctcttcgagttgcggaagtgtgg
atggaccagtacaaatctaatgtctatttggcatggaacctaccgatgaagaaccatggc
attgactatggagatgtatcggagagacttgcactcaggaaaagactccagtgcaaaagc
tttgactggtacctcgacaatatctatccagaaatgagaagatacaacaacactgtcttt
tatggagaaattcgcaataccaatgtgacccatctgtgtgtggaccagggcataaaggaa
aaccacacagcaactctgcacccgtgccatggctggggccctcagctgggtcgctacact
aaggagggttatcttttcctgggtcctctgggaagcactggcgaagatactcggtgtgtg
gtggacgataaaatcagcagctatccacagctcctcaactgcgagaaagtctcaagcgta
cggcaaaaaacttggcactttgcacagaatgaatcaatcatcagccgagctacaggacgc
tgcctcgaggtagtgccggctaatgtctactttggctacgctctaatcctgcgctcatgt
actggccagaagtggaacatcaagaatctgatgaaacaagaccaagggcagtga

DBGET integrated database retrieval system