KEGG   Danio rerio (zebrafish): 567859Help
Entry
567859            CDS       T01004                                 

Gene name
si:ch211-114l13.7
Definition
(RefSeq) procollagen galactosyltransferase 1 precursor
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00310  Lysine degradation
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    567859 (si:ch211-114l13.7)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    567859 (si:ch211-114l13.7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    567859 (si:ch211-114l13.7)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     567859 (si:ch211-114l13.7)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  O-linked Gal type
   567859 (si:ch211-114l13.7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 567859
NCBI-ProteinID: NP_001103992
ZFIN: ZDB-GENE-070424-114
Ensembl: ENSDARG00000058270
Vega: OTTDARG00000019415
UniProt: A5PMF6
LinkDB All DBs
Position
1
AA seq 604 aa AA seqDB search
MHLLCFFFLLLWTGPARSYFPEERWSPESALLAPRVLVALVCRNSAHSLPHVLGAIDRLN
YPKDRMAVWVATDHNSDNTTEILREWLVNVQNFYHYVEWRPQDEPSVYEGESGPKHWTNL
RYEHVMKLRQAALETAREMWADYFMLVDCDNLLTNRDVLWKLMRENKTIVAPMLESRAAY
SNFWCGMTSQGYYKRTPAYMPIRRQERKGCFAVPMVHSTLLLDLRKEASRQLAFFPPHPD
YTWAFDDIIIFAFSARMAEVQMYICNRETYGYFPVPLRSQNSLQDEAESFLHSQLEVMVR
NPPIEPSVYLSLMPKQTDKMGFDEVFMINLLRRSDRRERMLRTLYEQEIACKIITAVDGK
ALNASQVEALGIKMLPGYSDPYHGRPLTKGELGCFLSHYNIWNEIVDRGLQSSLVIEDDL
RFEVFFKRRLQNLMQEVQSQQLDWDLIYIGRKRMQVERPEKSVPRIHSLVEADYSYWTLG
YVISLRGAQKLLRAEPLKKMLPVDEFLPVMYNKHPIEEYMSHFPQRDLRAFSAEPLLIYP
THYTGDQGYISDTETSSVWDNESVLTDWDRARSRKSREQEELSSEAQNTDVLQSPLDSTA
RDEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgctgtgcttcttcttcctgctgctgtggaccggcccggcgcgctcttatttc
ccggaggagcgctggagcccggagtcggctcttcttgccccgcgggtgctggtcgcgctg
gtctgccgcaactccgcgcactccctgccgcatgtcctcggcgcaatcgaccgcttgaac
taccccaaagaccggatggctgtttgggtggccacagatcataactccgacaacaccacc
gagatcctgcgcgagtggctggtgaacgtgcagaacttctatcattatgtggagtggaga
cctcaggacgagcccagtgtgtatgagggtgaaagcggcccgaagcactggacgaatctg
cgatacgagcacgtgatgaagctccggcaggcggctctggagacggcacgcgagatgtgg
gccgactatttcatgttggtggactgtgataacctgctgactaatcgtgatgtgttgtgg
aaattaatgcgggaaaacaagacgattgtggcgccgatgctggaatccagagcggcatac
tccaacttctggtgcggcatgacgtctcagggttattataagcgtactccggcctacatg
ccaatccggcgtcaggagcgtaagggctgttttgcggtgccgatggttcactccacgctc
ctgttggacctgcggaaagaggcgtcccgtcagctggccttctttccgccccatcccgac
tacacctgggcctttgatgacatcattatcttcgccttctccgcacgcatggcagaggtt
cagatgtacatctgcaacagagagacgtatgggtatttcccggtgccgctgcgctcccag
aacagcctgcaggatgaggcggagagctttctgcactctcagctggaggttatggtgcgc
aatcctccaatagagccgtccgtgtatctgtcactaatgccaaaacagacggataaaatg
ggcttcgatgaggtgttcatgataaatctcctgaggcgctcagaccggcgcgagcgcatg
ttgaggacgctttacgagcaagagatcgcatgcaagatcatcacagctgtagatggcaag
gcactgaatgcaagtcaggtagaggctctggggatcaagatgctgcccggttacagtgac
ccgtatcacggacgcccgctgaccaaaggagagctgggctgctttctgtcccactacaac
atctggaacgagattgtggatcgtggcctgcagtcgtctctggtgatcgaggacgatctg
cgcttcgaggtgttctttaagcggcgtctgcagaatctgatgcaggaggttcagtctcag
cagctcgactgggatctgatttatattggccgcaagcggatgcaggtggagcgaccggag
aaatcagtgccacggatccacagtctggtggaggcagattactcgtactggacgctggga
tacgtgatctcgctccgcggtgcacagaagctgctaagagccgaaccgctcaagaagatg
ctgccggtggacgagtttctgcccgtcatgtacaacaaacaccccattgaggagtacatg
tctcatttcccacagcgggacctgcgggccttttctgcggagccactgctgatataccct
acacactacacaggagaccagggctacatcagcgacacagagacctccagcgtctgggac
aacgagagcgtgctgaccgactgggacagagcacgctcacgaaagagccgcgagcaggag
gagctgagcagcgaagcccagaacactgacgtcctgcaatcaccgctcgacagcacagcc
agagacgagctctag

DBGET integrated database retrieval system