KEGG   Danio rerio (zebrafish): 567895
Entry
567895            CDS       T01004                                 

Gene name
elk1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04510  Focal adhesion
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    567895 (elk1)
   04012 ErbB signaling pathway
    567895 (elk1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    567895 (elk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    567895 (elk1)
   04912 GnRH signaling pathway
    567895 (elk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    567895 (elk1)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    567895 (elk1)
SSDB
Motif
Pfam: Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 567895
NCBI-ProteinID: XP_696294
ZFIN: ZDB-GENE-090529-5
Ensembl: ENSDARG00000078066
LinkDB
Position
8
AA seq 521 aa
MESNPLISAMDPSITLWQFLLHLLDDQNQKHLISWTSGDGEFKLLDAEEVARLWGLRKNK
TNMNYDKLSRALRYYYDKNIIKKVSGQKFVYKFVTYPDPNSADGLKGTEDSQRASTGEKL
ELSIQTKPMGGATTANQCLSKSLQVQRSSPSSVQRSSRNDYMKSGLYSTFTIQSLQTPCK
GNSKLIKTEHVLNDCNPKPASLDRTMHEMRVCQTEGQQGSVQAQSTVESSNLQVIVTQPS
PCATPALSPQTPSGSATAITNNQAQKSQSLGDPPQIYLSDPSSLTSLIPLPPGECVVNPS
QHVFVVIKPPSVGQSKESSLSADEDLLEIVSLEDKADVEPVSAVPVPGVTDAPIPVDATS
PCVEPVGPPVGEGEVKEKPELPEDTNTASASLQASTQDVQPPKSKKPRVLELPSSSTLLP
PGLSLDKVNAAVNSLLASGSATNTLTPTVITSHSLTPVLLTPSPLPSTIHFWSTLSPIAP
RSPAKLSFQFPSNGSNQIQIPALSVDGLSTPVVLSPGPQKP
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggagtcgaatccgctgatcagcgcgatggatccgtccattacattgtggcagttcctg
cttcacctcctggatgatcagaatcagaagcacttgatatcctggacatctggggacggg
gaattcaaactgctggacgctgaggaggtggccagactctggggtcttcgcaagaacaaa
accaacatgaactatgataaactaagcagggcacttcgttactactatgataagaacatt
attaagaaagttagcggtcagaagtttgtctacaagtttgtaacctatccggacccaaac
tctgctgatggactgaaggggaccgaggattcccagagggcctctacgggggagaaactg
gagctgtccatccagaccaaacctatgggtggtgctaccaccgccaaccaatgcctctcc
aagagcctgcaggttcagcgctcctccccaagttcagtgcaacgcagctcccgcaacgat
tacatgaagtctggtctctactccactttcactattcagtctctgcagacgccctgcaaa
ggcaactccaaactcatcaaaacagagcatgtcttaaatgactgcaatcctaaacctgca
tctctggaccgcaccatgcatgagatgcgagtttgtcagacagaaggacagcagggaagt
gttcaagcgcagtcgactgtggagagcagcaatctgcaggtgatagtcacccagccttca
ccatgtgctacaccagccctcagcccccagactccctccggctctgccactgcaatcacg
aacaatcaagcacagaagagccagagtttaggagacccaccacagatctacctgtctgac
cccagttctctaacctcgctcattcctctgcctcctggagaatgtgttgtcaacccctct
cagcatgtgtttgtggtcataaagcctccgtctgttgggcagtccaaagagtccagcctt
tcagcggatgaagacttgctagagattgtcagtctggaggacaaagcagatgttgagccg
gtgtctgcagtgcctgttcctggagttacagatgccccaatccctgtggatgctacatcc
ccttgcgtggagccagtgggcccgccggttggagaaggagaagtgaaagagaaacctgag
ctacctgaggacaccaatactgcatcagcctccctccaggcgagcacgcaggacgtccag
cctcctaaatcaaagaagccacgtgtgctggagctgccatcctcgtctacactgttgccc
cctggactctcactggataaggtcaatgcagcggtgaacagcctgcttgcctctggcagt
gccacaaacaccttaacacccacagtcatcacctcacattccctgactccagtgctgctg
acaccgagtccgctgccatcaaccattcacttctggagcacgctcagtcctatcgctcca
cgcagccctgccaagctctccttccagttcccctctaacggaagcaatcagatccagatc
ccagcactgagcgtggacggcctttccacacctgtcgttctctcccctggaccacagaaa
ccataa

DBGET integrated database retrieval system