KEGG   Danio rerio (zebrafish): 567956
Entry
567956            CDS       T01004                                 

Gene name
lpar2b
Definition
(RefSeq) lysophosphatidic acid receptor 2b
  KO
K04291  lysophosphatidic acid receptor 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04080  Neuroactive ligand-receptor interaction
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    567956 (lpar2b)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    567956 (lpar2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    567956 (lpar2b)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    567956 (lpar2b)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 567956
NCBI-ProteinID: NP_001307062
ZFIN: ZDB-GENE-051120-99
Ensembl: ENSDARG00000042561
UniProt: F1Q734
LinkDB
Position
1
AA seq 369 aa
MVCYNNETVVFFYSISHKNISDTWGTKAKAVVGMGLLVSVFVIFTNILVMAAIFMNRRFH
YPIYYLLGNLAAADLFAGTSYMYLMFHTGPWTAKLTTYQWFVRQGLIDTSLTASVFNLMA
IALERHQTIFTMQLHSKMTNHRVVLLILGIWTVAIIMGLVPAMGWNCMCDIGNCSTMAPL
YSRSYLVFWAAINLLTFTVMVAVYTRIFIYVRRKSQRMSQHTSQVKHKETVVNLMKTVVM
ILGCFVVCWTPGMVLLLLDGLCHSCDVLTYEKFFLVLAESNSLMNPIIYSYRDKDMRDTF
KRILCLCCRSKQSEEHSGVRFNTLEQERRRRVQQESYLARRARDAGAQQENGGRLVLQEN
KEMLESSDS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggtttgctacaacaacgagaccgtggttttcttctacagcatcagccataagaacatc
agcgatacgtgggggactaaagcgaaggcggtggtgggtatggggctgctggtcagtgtt
tttgtcatcttcaccaacatcctggtgatggcggccatcttcatgaaccgccgctttcac
taccccatttattacctgctggggaacctggcggcggcagatctgttcgccgggacgtcc
tacatgtatctgatgttccacaccgggccctggaccgccaagctcaccacataccagtgg
ttcgtgcggcagggtctaatcgacaccagcttgacggcgtccgtctttaacctgatggcg
atcgcgctggagcgccaccagaccatcttcaccatgcagctgcacagtaagatgaccaac
catcgggtggtgctgctgatcctgggcatctggacagtggccatcatcatgggtctggtg
cccgctatgggctggaactgcatgtgcgacatcgggaactgctccacaatggcgccgctc
tacagccgcagctatctggtgttctgggccgccatcaacctgctgaccttcaccgtgatg
gtggccgtctacacgcgcatcttcatttacgtgcggcgcaagagccagcgcatgagccag
cacacctcgcaggtcaaacacaaggagacggtggtcaacctgatgaagaccgtcgtcatg
atcctcggctgtttcgtggtgtgctggactccaggtatggtgctgctgctgctggacggg
ctctgccactcctgtgatgttctgacctatgagaagttcttcttggttctggccgagagc
aactccttaatgaaccccatcatctactcgtaccgggacaaagacatgagggacaccttc
aagcggatcctgtgcctgtgctgccggtccaagcagagcgaggagcactcgggcgtgcgc
ttcaacaccctggagcaggagaggagacggcgtgtgcagcaggagtcgtatctcgctcgc
agggctcgggatgcaggagcgcagcaggagaatggaggacggctggtgcttcaggagaac
aaggagatgctggagtccagcgacagctga

DBGET integrated database retrieval system