KEGG   Danio rerio (zebrafish): 568500Help
Entry
568500            CDS       T01004                                 

Gene name
galnt8a.2
Definition
(RefSeq) probable polypeptide N-acetylgalactosaminyltransferase 8
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C CDtoxinA
Motif
Other DBs
NCBI-GeneID: 568500
NCBI-ProteinID: XP_021326339
ZFIN: ZDB-GENE-131122-40
Ensembl: ENSDARG00000011869
LinkDB All DBs
Position
25
AA seq 609 aa AA seqDB search
MRIGARVSVLFIIGIIVYSVVNVSFIRPERNNDSTLQKPEEIELFQRLKRIEDEVHEIAI
NIKNQNVKEAVVKQKITKKTEVKKLYPKSALFKTWGAELTEEEQMEAEKLFQEFGYNVFL
SNRLPLNRTIPDTRDPRCSLKIYPKDLPTISVILIYLNEALSVIKRAVQSIIDKTPAHLL
KEIVLVDDNSSNEDLKLPLDKYIDLINKGKPGLIKKVRHKKQMGLAKARMSGWEAATGQV
VAILDAHIEVHKEWAEPLLAQIKANRTTVLSPVFDKVLFDTLEVIKYNPAAHAFDWSLWC
MYERFRPEWYKLKDPSEPGKSPSVMGILVADREFLGEIGVLDEGMTIYGGENVELGIRVW
LCGGSVEVVPCSKIAHVERAHKPYSPDLSKLMIRNALRVAEIWMDEYKSNVNIAWNLPLK
DHGIDIGNVTERKQLREKLKCKPFKWYLENVYPLLDRWDDILGYGVLKNDILKTHCIDQG
PVPGSVPVLFGCHYYGPQRCYYKRTGEIYVGSIKSHTYNSNRCLTDPGSGSTVTLYNCKY
AKEKGFSIYWDFTQGKEIRNKKTNRCIELAQGQDTYYYLVLQACTGQEWTIQHAFEELKG
NFTEVKATK
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaggattggagcgagggtcagcgtgttatttattattggtatcatagtgtacagtgtg
gtgaacgtgtcgtttatcagaccagagaggaataatgacagcacattacagaagccagag
gagatagagctttttcaaaggctaaagaggatagaagatgaagttcatgaaatagccatt
aacatcaaaaaccaaaatgtcaaagaggctgttgtgaaacagaaaatcactaagaaaact
gaggtgaagaagttatatccgaagtcagctcttttcaaaacctggggagctgaactgaca
gaagaggaacagatggaagcagagaaactgtttcaggagtttggatacaatgttttcctc
agtaacagattaccattgaacagaacaatccctgatactcgagatcccagatgttctctg
aagatctatccgaaggacttgccaaccattagtgtgattctgatttatctgaatgaggct
ctgtcagtcattaaaagagccgttcagagcatcattgacaaaactcctgctcatctgctt
aaggagattgtcctggtagatgacaacagctctaatgaggatctgaaattgcctttagac
aaatatattgatctaattaacaaaggcaaacctggtttgatcaagaaagtgcgacacaaa
aagcagatgggtctcgccaaggcaagaatgtcaggctgggaagccgccacaggtcaagtg
gtcgccattctggatgcccacattgaagttcataaagaatgggcagagccactacttgca
caaattaaagcaaacaggacaactgtattgtcaccagtgttcgacaaagtgctttttgac
acactggaggttattaagtataatcctgctgctcatgcatttgattggagcctttggtgc
atgtacgagcgcttccggccagaatggtacaaactcaaagacccatcagaaccagggaag
agtccttcagtcatgggtatccttgtcgctgaccgtgagttcctgggagaaattggagtt
ctggatgaaggaatgacaatttatggtggtgaaaatgttgaactaggcatacgtgtctgg
ctctgtggtgggagtgtcgaagtggtgccatgttcaaagattgcgcatgttgaaagagca
cataagccttattcaccagatctcagcaaactcatgatacgaaatgcattgagagtggct
gaaatctggatggatgaatataaatccaatgtgaatatcgcctggaatctgcctctgaag
gatcatgggattgatattggtaatgtgactgaaagaaaacagttacgtgagaaactcaaa
tgtaagcccttcaaatggtatctggaaaatgtatatcctctgctcgacagatgggacgac
atactgggttatggtgtgttgaagaatgacattcttaaaactcactgcattgatcaagga
cctgttcctggaagtgtacctgttctctttgggtgtcattactacggccctcagcgttgt
tactacaaacgtactggagagatttatgttggcagcattaaatctcacacttataactct
aatcgttgtctgacggatcctggtagtggaagcactgtgactttatataactgtaaatat
gccaaggagaaaggatttagtatttactgggacttcactcagggaaaagaaataagaaac
aaaaagacaaaccgatgtattgaattagcacaaggacaggatacatactattatctagtt
ttgcaagcatgcactggacaagaatggacaattcaacatgcctttgaagaactaaagggg
aatttcactgaagtgaaagcaacgaagtga

DBGET integrated database retrieval system