KEGG   Danio rerio (zebrafish): 568645Help
Entry
568645            CDS       T01004                                 

Definition
(RefSeq) probable polypeptide N-acetylgalactosaminyltransferase 8
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Trns_repr_metal Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 568645
NCBI-ProteinID: XP_697079
LinkDB All DBs
Position
25
AA seq 558 aa AA seqDB search
MVNSCLCLNSANIHGKLNGHTGNSGPGENNKSRLKKPEDLEVLQRLKRIEDQVHKIAKFI
EVDEAVVKQKDTKKTKVKKLYPKSALFKIWGAELTEEEQMEAEKLFQEFGYNVFLSNRLP
LNRSIPDTRDPRCALKIYPKDLPSISVILIYLNEALSVIKRAIQSIIDKTPAHLLKEIVL
VDDNSSNEDLKLPLDEYVSLFNKTKPGLIKKVRHKRQMGLAKARMSGWEAATGQVVAILD
AHIEVHKEWAEPLLTRIKADRTTVLSPVFDKVFFDTLEVTKYSPAAHAFNWNLWCMYESF
RPEWYKLKDPSEPGKSPSVMGILVADRQFLGEIGVLDEGMTIYGGENVELGIRVWLCGGS
VEVVPCSKIAHIERAHKPYSPDLSKPMIRNALRVAEIWMDEYKSNVNIAWNLPLKDHGID
IGDVTERKQLREKLKCKPFKWYLENVYPQLDRWDDIMGYGALENDLFENHCIDQGPVPGS
VPILYGCHYYSPQHCYYRLNGEIYVGGIKSHTYNSNRCLTDPGNGNMPTLHNCKNAKQKG
LSIYWDFTQTKYELPHPP
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtcaactcctgtctgtgtctcaactccgccaacattcatggcaagctaaatggacac
actggtaacagtggaccaggggaaaacaataaaagcaggttaaaaaagccagaagatctg
gaagttcttcaaagactgaagagaatagaagaccaagttcataaaatagctaaattcata
gaagttgatgaggctgtcgtaaaacagaaagatacaaagaaaacgaaggtgaagaagtta
tatccaaagtcagctctttttaaaatctggggagctgaactgacagaagaggaacagatg
gaagcagagaaactgtttcaggagtttggatacaatgttttcctcagtaacagattacca
ttgaatagatcaatccctgatactcgagaccccagatgtgctttgaagatctaccctaag
gacttgccaagcattagtgtaattctgatttatctgaatgaggctctgtcagtcattaaa
agagccattcagagcatcattgacaaaactcctgctcatctgctaaaggagatcgtcctg
gtagacgacaacagctccaatgaggatctaaaattgcctttagatgaatatgtcagtcta
tttaataaaaccaaacctggattaatcaagaaagtgcgacacaaaaggcagatgggtctc
gcaaaggcaagaatgtcaggctgggaagcggccacaggtcaagtggtcgccattttggat
gcccacattgaagttcataaagaatgggcagagccacttcttacacgaattaaagcagac
aggacaactgtattgtcaccagtgttcgacaaagtgttttttgacacactggaggttact
aagtatagtcctgctgctcatgcgtttaattggaacctttggtgcatgtacgaatccttc
cgaccagaatggtacaaactcaaagacccatcagaaccagggaagagtccctcagtcatg
ggtatccttgtcgctgaccgtcagtttctgggagaaattggagttttggacgaaggaatg
acaatttatggtggtgaaaatgtagaactgggaattcgtgtctggctctgtggtgggagt
gttgaagtggtgccgtgttcaaagattgcgcacattgaaagagcacataagccttattca
ccagatctcagcaaacccatgatccgaaacgcattgagagtggctgaaatctggatggat
gaatataaatccaatgtgaatatcgcctggaatctgcctctgaaggatcatgggattgac
attggtgatgtgactgaaagaaaacaattacgggaaaaactcaaatgtaaacccttcaaa
tggtatctggaaaatgtctatcctcaacttgacagatgggacgatataatgggttatggt
gcgttggagaatgacctttttgaaaaccattgcattgatcaagggcctgttcctggaagt
gtgcctattctctatgggtgtcattactacagccctcagcattgttactacagacttaat
ggagagatctatgttggcggcattaaatctcacacttacaactctaaccgttgtctaacg
gatcctggtaatggaaatatgccaactttacataactgtaagaatgccaagcagaaagga
ttgagtatttactgggacttcactcagacaaaatatgagctccctcatcctccataa

DBGET integrated database retrieval system