KEGG   Danio rerio (zebrafish): 568915Help
Entry
568915            CDS       T01004                                 

Gene name
si:ch211-15e22.3
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase-like 6
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    568915 (si:ch211-15e22.3)
   00514 Other types of O-glycan biosynthesis
    568915 (si:ch211-15e22.3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    568915 (si:ch211-15e22.3)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     568915 (si:ch211-15e22.3)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   568915 (si:ch211-15e22.3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C Glyco_tranf_2_2 Fer4_NifH
Motif
Other DBs
NCBI-GeneID: 568915
NCBI-ProteinID: NP_001139074
ZFIN: ZDB-GENE-090312-115
Ensembl: ENSDARG00000040048
Vega: OTTDARG00000029910
UniProt: B8A6C4
LinkDB All DBs
Position
1
AA seq 600 aa AA seqDB search
MKRRQKRVLQMAFLFMVALIFLPNVGLWSMYREKSLMKSHEPGEQGFPLGLNDGHIYTWT
DGLRRRDWHDYESIRKDGQRVGKGEHGKPYPLVEDECDDSVYKENGFNIYVSNNIALDRS
LPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTLHSISNRTPDHLIAEIILVDDY
SDREHLKAHLAEYMSRFPKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEANINW
LPPLLDQIAQNPKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQGP
DPSDPYQSPVMAGGLFAVNRQWFWELGGYDTGLEIWGGEQFEISFKVWMCGGSMYDVPCS
RVGHIYRKYVPYKVPSGTSLARNLKRVAETWMDEYTEYIYQRRPEYRHLSTGDLTAQKEL
RKHLKCKDFKWYMNTVAWDLPKYYPPVEPLPAAWGEIRNAASGLCVDSKHGSTGTELRLD
NCLKEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQNSPITLYDCHGMKGNQH
WSYRKDKSLYHLVSSGCMDCSPNDKRIFMNKCDPKSETQQWIFQKVNATVLDKFNSAASS
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaaggcaaaagcgcgttctgcagatggcatttctgttcatggtggctttaatt
ttcctgccaaacgtcggcctttggtcaatgtacagagagaagagccttatgaagtcgcac
gagcctggagagcagggcttcccactgggcttaaatgacggtcacatttatacctggaca
gacggattgaggagaagagactggcatgactatgagagcatcaggaaagatgggcaacgt
gttggaaaaggagagcatggaaagccatacccgcttgttgaggatgagtgtgatgactct
gtgtacaaagagaatggtttcaacatctacgtcagcaacaatatcgctctggatcgctcg
cttcctgacatccgacatccaaactgtaagcagaagctttatcttgaaaacctcccaaac
acgagtatcatcatcccgttccacaatgaaggctggtcctctctgctcagaaccctccac
agcatcagcaaccgaacaccggatcacctgatcgcagagatcatactggtggatgactac
agcgacagagagcacctgaaggcacatctggcggagtacatgtccagatttcctaaagtc
cgtattgtgcgcactaagaagcgagagggtctaatccgcacacgacttctgggagcatct
gtggccagaggagaggtcctgacttttctggattctcattgtgaagccaacatcaactgg
ctgccacccttgcttgatcaaatcgcccaaaatcccaaaaccattgtatgccccatgata
gatgtgattgatcataatcactttgggtatgaagcgcaagctggggatgccatgagagga
gcttttgactgggagatgtactataaacgtattcctatcccacctgagctgcaaggacca
gaccccagtgacccatatcagtctcctgtgatggccggaggcttgtttgctgtaaaccga
cagtggttctgggagctgggaggttacgacacaggccttgagatctggggtggcgagcag
tttgaaatatccttcaaggtgtggatgtgcggaggcagcatgtacgatgtgccttgttcg
agggtgggccatatctacaggaagtacgtcccctacaaggtgccttcagggaccagcctg
gcaagaaacctgaagcgagttgcagagacatggatggatgagtacacagagtacatctat
cagcggcggcccgagtaccgccacctttccaccggtgaccttaccgctcagaaagagctc
cgaaaacacctcaaatgtaaagacttcaaatggtatatgaacactgtggcttgggacctg
cccaaatattacccacctgtggagccactgccagctgcctggggagagattcgtaacgca
gcatctggcttatgcgtcgactctaaacatggctctacaggcactgagctccgattggac
aattgtctgaaagagggcgcagagcgaacatgggcacatgagcagattttcacgtttggc
tggagagaggacatcaggcctggagatccactgcacaccagaaaattctgcttcgatgct
attagccagaacagccctatcacgctctatgactgccatggcatgaaaggcaaccagcac
tggagctacaggaaggataagtctttgtaccacctggtgagcagcggttgcatggactgc
agcccgaacgataagcggattttcatgaacaagtgtgatcccaagtctgaaacacaacag
tggatcttccagaaagtcaacgccaccgttctggacaaattcaacagcgccgccagctct
tag

DBGET integrated database retrieval system