KEGG   Danio rerio (zebrafish): 571825
Entry
571825            CDS       T01004                                 

Gene name
adcy3a
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
dre04020  Calcium signaling pathway
dre04114  Oocyte meiosis
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
dre04371  Apelin signaling pathway
dre04540  Gap junction
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    571825 (adcy3a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    571825 (adcy3a)
   04020 Calcium signaling pathway
    571825 (adcy3a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    571825 (adcy3a)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    571825 (adcy3a)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    571825 (adcy3a)
   04914 Progesterone-mediated oocyte maturation
    571825 (adcy3a)
   04916 Melanogenesis
    571825 (adcy3a)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    571825 (adcy3a)
   04270 Vascular smooth muscle contraction
    571825 (adcy3a)
Enzymes [BR:dre01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     571825 (adcy3a)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA OPA3 Peptidase_S49_N Calmodulin_bind DUF1053
Other DBs
NCBI-GeneID: 571825
NCBI-ProteinID: NP_001156014
ZFIN: ZDB-GENE-111027-6
Ensembl: ENSDARG00000077145
LinkDB
Position
16
AA seq 1071 aa
MPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPD
SLENLYQTYFRRQRHETLLVLVVFAALFDCYIIVMCTVLYTADKLASVAVASVGLAADVL
LYLLCRYGLLPDRVTRRLVPYALWVLIAAQIFCYLGLNFARFHQPSDTVGWQAFFSFSFF
LTLPLRLTPIVLITSVSCGVHTLVLGVTIAQQQQEDIQGAALGRQLLANMVIYVCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEAS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEMEAGGIPGRVHISQNTLECLHGEF
DVEPGNGGDRCEYLKERGIETYLVVLPKGPVGKNGINGVKLSVTSSNGNSPLLINTTECN
GSVHTACTTPEDPEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALL
ERETVQALKGKYTNRLSLRFTDPELETRFSVEKEKQSGAAFSCSCVVLLFTAVMEALIDP
WLVANYVTLAVGEVLLLILTICSLAAIFPRVFPKRLVSFSTWIDHTRWARNTWAMAAIFI
VTLADIVDMLSCRAPQTSTVESTAVPPVVTAIRGCAENPKYYSFIAVLALIATTMLVQVS
HMVKLTLMLLITVATGAVNIYSWSQTFDLYDLTRFKEYRVNLVPSKYTMSVMIFIMMVSF
YYFSRHVEKLARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEE
LYSQSYDEIGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRCITK
IKTIGSTYMAASGVTSDNNTNGYACMKKEEISDRERWQHLADLADFALAMKVTLMNINYQ
SFNNFMLRIGLNKGAVLAGVIGARKPHFDIWGNTVNVASRMESTGVMGNIQVVEDCYCIL
KDYGFRFVRRGPIFVKGKGELLTYFLKGREKQGSFINGSFVTLPHQVVDSS
NT seq 3216 nt   +upstreamnt  +downstreamnt
atgcctcgtaaccgggccttttcagagccggagtactctgcggagtattcagcggactgc
tcagtcaccttgccctctgaccccgggcaggcggtgggacgcacccatgaggtgacggtg
cgcagctctggctgctgcctgtgtctgccgcgcttcatgcgtctgacctttgcgccagac
tctctggagaatctctaccagacctatttccgacggcagcggcacgagaccctgctggtg
ctggtggtgttcgcggcgctctttgactgctacatcattgtgatgtgcactgtgctctac
acggccgataagctggcatcggtggccgtggcgtctgtgggtctggctgcagatgtgctg
ctgtatttgctgtgccggtacggcctgctgccggaccgcgtcacccgccgcctcgtgccc
tacgccctatgggtgctcatagcagcccagatcttctgttatctaggattgaactttgcc
cgcttccatcagcccagcgacaccgtaggctggcaggcgtttttcagcttctccttcttt
ctgacgctgccgctgagactgacccctatagtgctgatcaccagcgtgtcctgcggggtc
cacaccctggtcctgggggtcaccatcgcccagcagcagcaggaggacatccagggtgcc
gctttggggagacagttgctggccaacatggtgatctacgtctgtgccatcacagtgggc
gtcatgtcgtattacatggccgaccgcaaacaccggaaggcctttctggaggcgcgtcag
tctctggaggtcaaactcaacctggaggagcaaagccagcagcaggagcgtctgctgttg
tccatcttgcccaaacacatcgcagacgagatgctccaggacatgaagaaggaagccagt
cagaaggagatgcagcagttcaacaccatgtacatgtaccggcacgagaacgtcagtatt
ctgttcgcagacatcgtgggctttactcagctgtcctcgtcctgcagcgcgcaggaactg
gtcaaactcctcaacgaactgtttgcgcgtttcgacaagctcgcggcgaaataccaccag
ctgaggatcaagattctgggcgactgctattactgcatctgtggccttccagactaccga
gaggaccacgccgcctgctctatcatgatgggtttggccatggttgagatggaggccgga
ggaataccagggcgagtgcacatctcccagaacaccctggagtgtttgcacggggagttt
gacgtggagccggggaacggaggcgaccgatgcgagtacctgaaggagcgcggcatcgaa
acctacctggtggtccttcccaaggggccagtgggcaaaaatggcatcaacggagtaaag
ctttcggtgacgtcgtctaatggtaattctccattgctgatcaacactacggagtgcaac
ggaagcgtccacacggcctgcaccacgccggaggatccagaagagctcgacacacgggtg
gtgaacccgtcgttcccgaacccgcgtcgtcgattgcgtctacgagatctggcggagaga
gtgatcgacgctcaggagaacgaacaggagctcaataaactcctcaacgaagctctgctg
gagagagaaactgtgcaggcgctgaaagggaagtacaccaaccgtctgtccctgcgcttc
accgaccccgagctggagacgcgcttctcagtggagaaggagaagcagagcggcgccgcg
ttcagctgctcgtgtgtggttttactcttcactgctgtcatggaggccctcatcgacccc
tggttggttgcgaactatgtgactctggctgtaggggaagtgctgctgcttattcttacc
atctgttctctggcggccatttttccccgggtatttccaaagaggttggtgtcgttctcc
acctggattgaccacacacgctgggctcgcaacacttgggccatggctgccattttcata
gtcacattggcggacatagtagatatgttgagctgtcgtgcgcctcagacctccacagtt
gagtccaccgcggttcctccagtcgttactgccatccgtggctgtgcagaaaatcccaaa
tactacagtttcatcgccgtcctggcgctcatcgccaccaccatgctggtgcaggtcagc
cacatggtcaaactcacgctcatgctgctgatcactgtggccaccggtgcggtcaacatt
tacagctggagccaaacctttgacctctacgacctcactcgcttcaaggagtacagggtt
aatctggtgccgtccaaatacaccatgagtgtgatgatcttcatcatgatggtcagcttc
tactacttctcccgacatgtagagaaactggcccgcacactgtttctatggaagattgaa
gtgcacgagcagaaggagaaggtgtatgagatgcggcgctggaacgaggctctggtcact
aatatgctcccggagcacgtcgccagacactttctgggctctaagaagagagatgaggag
ctctacagccagtcctacgatgagattggagtcatgttcgcctccatcccaaacttctcc
gacttctacacggaggaaagcatcaacaatggcgggatcgagtgcctgaggttcctcaat
gaaatcatctctgatttcgatagtcttttggacgagccacagtttcgctgtataaccaaa
atcaagacgattggcagcacctacatggcagcatcaggagtcacctcagacaataacacc
aacggctacgcttgtatgaagaaagaagagatttccgacagagagcgttggcagcatttg
gcggatcttgctgactttgctctggccatgaaagtcacgctgatgaacatcaactaccag
tccttcaataacttcatgctccgcatcggactgaataaaggggccgttttggcgggtgtt
attggggcccgtaaacctcactttgacatctggggaaacactgtgaacgtcgccagtcgt
atggagtccacaggggtgatgggaaacatccaggtggtcgaggactgttactgcatcctg
aaggactacggtttccgcttcgtcaggcggggtcccatatttgtcaaaggcaaaggagag
ctgctcacatacttcctcaagggacgcgaaaaacaaggctccttcatcaacggctcgttt
gtcaccctgccgcaccaagtggtggacagctcttga

DBGET integrated database retrieval system