Danio rerio (zebrafish): 571834 Help Entry 571834            CDS       T01004                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism dre  Danio rerio (zebrafish) Pathway dre03030   DNA replication dre03410   Base excision repair dre03420   Nucleotide excision repair dre03430   Mismatch repair dre03440   Homologous recombination Brite KEGG Orthology (KO) [BR:dre00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     571834 (pold4)    03410 Base excision repair     571834 (pold4)    03420 Nucleotide excision repair     571834 (pold4)    03430 Mismatch repair     571834 (pold4)    03440 Homologous recombination     571834 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dre03032]     571834 (pold4)    03400 DNA repair and recombination proteins [BR:dre03400]     571834 (pold4) DNA replication proteins [BR:dre03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     571834 (pold4) DNA repair and recombination proteins [BR:dre03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       571834 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      571834 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 PKcGMP_CC Motif Other DBs NCBI-GeneID:  571834 NCBI-ProteinID:  NP_001243129 ZFIN:  ZDB-GENE-050506-118 Ensembl:  ENSDARG00000079632 UniProt:  F1R563 LinkDB All DBs Position 1:complement(44707054..44710935) Genome browser AA seq 117 aa AA seqDB search MTISYQRPDMTPKRGLITDTFKVVKKARRGGKRSKSPSPPKAEPEPPQLSEREKDIQELK NFDLDWKFGPCTGISRLQRWERAALHGLNPPQEIKDILLKEDTDPEYTQSLWRDYPF NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgacgatatcctatcagcgtccagatatgacaccaaagcgtggcctcatcaccgacacc tttaaggttgtgaagaaggcaaggagaggaggcaagagaagcaagtctccttcaccaccg aaagcagagcctgaacccccacaactgagtgaaagagaaaaagatatacaggagctgaag aactttgatctggattggaagtttggaccatgcacagggatcagtcgactgcagagatgg gagagggcagcactgcatgggctgaatcccccgcaggagattaaagacattttgctgaag gaggacactgacccagagtacacacagagtctctggcgtgactatcctttctga

DBGET integrated database retrieval system