KEGG   Danio rerio (zebrafish): 572849Help
Entry
572849            CDS       T01004                                 

Gene name
kmt5b
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    572849 (kmt5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    572849 (kmt5b)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     572849 (kmt5b)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     572849 (kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 572849
NCBI-ProteinID: NP_001007338
ZFIN: ZDB-GENE-041114-22
Ensembl: ENSDARG00000041081
Vega: OTTDARG00000013826
UniProt: Q5U3H2
LinkDB All DBs
Position
18
AA seq 808 aa AA seqDB search
MGESKNMVLNGRRHGRKFSSNQPVSKSRLQNTQRSHLRQNKGSPSVRRCSRRCGGAPPEA
ERRHVPSSGMTAKELCEYDDLSTSLILDPYLGFQTHKMNTRFRPIKGRQRELREIIELFK
KHDNLEKAFQALTSGDWTRHHFLNKTKSQEKLFKAHVFVYLRMFASDSGFEILSCNRYSS
EQNGAKIVATKDWKRNDKIEHLVGCIAELSPSEERMLLRHGENDFSVMYSTRKNCAQLWL
GPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGENNEFCECYTCE
RRGTGAFKSKPGLPVEAPVINSKYGLRETDKRLNRLKKLGESCRNSDSQSVSSNAEADSQ
EPTTVQTSLRKRTSQSCVKKHGEAKAVTRQTLSSTPSSTSSSKRSQANISSLPKRLKSKP
TQTLSKGRRRCRGLWTKGSSRVSASGNLKESSRRDTDRRRSASKGSVARSSENNRSSSKG
ASPCKDSTLCPYRTRRSTRTSLGAQGAEGTEASNHPASPSIVLKSEPGEFIPVTPGHQMS
TPSLDSSCPKKGTCPRRRRTVKQEDSYGESFVQEGVPDLRHAVRAADVADCGKVVLGLPD
RHQHYNGSSKSSKALRRGKGKKKRQITRYDAQLILQNNSGIPKITLRRRRDSSSSKNEPR
ETSSSSSSKISIKFSKEHEKDRSSSYVAKLNNGFSHGPHSSSTKLKIQLKREEDPASLHR
TYPEDVTLGIVQRDAADVLDHKAAAQVGQDMEVESMSSEDDDDDYFDNEDDFIPLPPAKR
LRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatccaagaacatggtgctgaatggcaggagacatggcagaaagttctccagt
aatcagcccgtaagcaaatccaggctgcaaaacacacagagatcccatcttcgccagaac
aaaggctccccgagtgtcagaagatgcagtcgacgttgtggtggggcgcccccggaggca
gaaaggcgtcatgttccttcatcgggaatgactgccaaggagttgtgcgagtatgatgat
ctgagcaccagtctgatcctggatccataccttggctttcagacccacaagatgaacacc
aggtttcgaccaatcaaaggccggcagagggagctgagggagatcattgagcttttcaag
aagcatgacaacctggagaaagcttttcaggctctgacatctggagactggaccagacat
cattttctcaacaagaccaagtcccaggagaagctcttcaaagcacatgtgtttgtttac
cttcgcatgtttgcttcagacagcggctttgagatcctttcttgcaatcgctactcctct
gagcaaaatggagccaaaattgtagcaacaaaagattggaaaaggaatgataaaatcgaa
catcttgtgggctgtattgctgagttgtctcccagtgaagagcggatgttgcttcgacat
ggagagaatgatttcagtgtcatgtactcaacacgcaaaaactgcgcacagctctggctg
ggacctgcagcttttattaaccacgattgcaggccaaactgcaagtttgtgtcaacaggc
cgagataccgcctgtgtaaaggttctacgggacattgaaccaggggaagagatctcctgc
tactatggagatggattctttggagaaaacaatgaattctgtgaatgctatacttgtgaa
aggcgtggcactggagcttttaaatcgaaaccagggttacctgttgaagctccagtgatc
aatagcaagtacggcctcagagagacagacaagcgtctgaacagactgaagaagctgggg
gaaagttgcaggaactctgacagccagtctgtcagttccaatgcagaggcagactctcag
gaaccaaccactgtacaaacatcattacgtaagagaacttcacagtcctgtgtcaaaaag
cacggagaagctaaggctgtaacaaggcaaactctgtcaagcactccttcttctacctca
tcctctaaacgaagtcaagcgaatatttcaagtttaccaaagagacttaagtcaaagccc
acacagactttgtctaaaggaagacgacgctgtcgaggcctatggacgaaaggttctagc
cgagtgagcgctagcggaaatctcaaagagtcctctagacgagacacagacagacgtaga
tctgcaagcaaaggcagtgttgcgcgttcatcagaaaacaatcggagctcttcaaagggt
gcttccccatgcaaggacagcacactttgcccttacagaactcgtaggtccacgaggact
tctcttggtgctcagggggctgaaggcacagaggcttcaaaccacccggcgagcccgagc
atcgtcctcaagtcagagcctggagagttcattcctgtgacacctgggcaccagatgagc
actcctagtttggactccagctgtcccaagaaagggacttgtcctagacgcagaaggaca
gtaaaacaggaagactcctacggcgagtccttcgtccaggagggcgttccagatctgcgg
cacgcggttcgggctgcagatgtagcagactgtgggaaggtggtgctcggccttccagac
cgccaccagcactacaacggctcctctaagagcagcaaggccctccgtcgagggaaaggc
aagaagaagcgacagatcacacgctatgacgctcagctgattctgcagaataactcaggc
atccccaagataacactacgccggcgtcgagacagcagcagcagcaagaatgagcccaga
gagaccagctcctcaagctcctccaaaatcagcatcaagttcagcaaggagcacgagaag
gaccggagcagctcgtacgtagccaaactcaacaacggcttcagccacggaccgcacagc
agctccaccaagctcaagatccagctgaagcgggaggaagaccccgccagcttgcaccgc
acttacccggaggacgtcaccttgggcatcgtgcaacgagacgctgcggacgtcctggat
cacaaggcagccgctcaggtaggtcaggacatggaagtggaatcgatgtcgtcagaggac
gacgacgatgactactttgataacgaggatgatttcatcccgctcccaccagcaaaacgc
ctgcgcctcatcgtgggcaaagattccatagacattgacatttcctccagacggcgagaa
gatcagtcgctcagactcaacgcataa

DBGET integrated database retrieval system