KEGG   Danio rerio (zebrafish): 641495Help
Entry
641495            CDS       T01004                                 

Gene name
poglut1
Definition
(RefSeq) protein O-glucosyltransferase 1 precursor
  KO
K13667  protein glucosyltransferase [EC:2.4.1.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    641495 (poglut1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    641495 (poglut1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     641495 (poglut1)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  O-linked Glc type
   641495 (poglut1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_90 Glyco_trans_1_2
Motif
Other DBs
NCBI-GeneID: 641495
NCBI-ProteinID: NP_001032511
ZFIN: ZDB-GENE-051120-24
Ensembl: ENSDARG00000053463
UniProt: Q32LR4
LinkDB All DBs
Position
1
AA seq 389 aa AA seqDB search
MERMWLLMVSFIILQTGVEFCVSDNAKQWQTFIRKITEATKNYQPCSQDNCTCYQSVLKD
DLRPFKNGISEGLMADTVNRGVGTHYQIISKKLYREQSCMFPARCSGVEHFILKVIDRLP
DLEVVINVRDYPQVPGWIQPVLPVLSFSKTKDYQDIMYPAWTFWEGGPAVWPIYPTGLGR
WDLMRDDLKRSVEQWPWKKKSPKGFFRGSRTSSERDPLILLSRAAPDLVDAEYTKNQAWK
SDKDTLGKPPAKEVTLVDHCEYKYLFNFRGVAASFRLKHLFLCGSLVFHVGEEWIEFFYI
QLKPWVHYIPVKQDLSDLSELLQFVKENDAVAEEIAIRGRNFILDHLRMEDLYCYWEMLL
TDFSKLLTYKPKRKSNFNQITHRASRSEL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaatgtggttgcttatggtttctttcattattttgcagactggcgtagaattt
tgtgtttcagataacgcaaaacaatggcagacattcataagaaagattacagaagctaca
aaaaattatcagccttgcagtcaagataattgcacctgttatcagagtgtcctgaaagat
gaccttaggccatttaaaaatggcatttctgaaggtctcatggcagacacagtcaacaga
ggtgttggcactcactaccaaataatcagtaaaaagctgtacagagaacaaagctgcatg
ttccctgcaagatgcagtggtgtcgagcacttcatcctgaaagtaattgacaggttacca
gatttggaggttgtgataaatgtgcgagactatccacaggtacctggatggatccagcca
gtcttgcctgtattgtcttttagcaagacaaaagactaccaggacataatgtaccctgca
tggacattttgggagggaggtcctgctgtatggcccatttaccccactggtctgggccga
tgggacctcatgagggatgacctcaaaagatcggttgaacaatggccctggaaaaagaaa
agcccaaaaggattttttagaggctctaggaccagttcagagagggaccctctgatcctt
ctctcaagagcagcgcctgaccttgtagatgctgaatacaccaaaaaccaggcctggaag
tctgataaggacactcttggtaaacctccagccaaggaagttactctggtagaccactgt
gaatacaaatacctctttaacttcagaggtgttgctgctagcttccgtttaaagcatctt
ttcctgtgtggttcattggtttttcatgttggggaagagtggattgagtttttctacatt
cagctcaagccctgggttcactacatccctgtcaagcaagatttgtctgacttgagtgaa
ctgcttcagtttgtgaaagaaaatgatgcagtggcagaagaaattgctataaggggccgg
aactttattcttgatcatctccgaatggaggatttgtattgttactgggagatgctgctc
actgatttcagcaagctgctgacatacaaacctaagagaaaatcaaacttcaatcagatc
acccacagagccagcaggtctgaactatga

DBGET integrated database retrieval system