KEGG   Danio rerio (zebrafish): 641564Help
Entry
641564            CDS       T01004                                 

Gene name
zgc:123295
Definition
(RefSeq) uncharacterized protein LOC641564 precursor
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 641564
NCBI-ProteinID: NP_001032651
ZFIN: ZDB-GENE-051127-11
Ensembl: ENSDARG00000056324
Vega: OTTDARG00000021648
UniProt: Q2YDQ2
LinkDB All DBs
Position
3
AA seq 310 aa AA seqDB search
MKINTALTVVGALLVNIAGSLCQLNVCGRAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGG
HFCGGSLINKDWVLSAAHCFQDSIGTIMVKLGLQSQSGSNPYQITKTVVQVINHPNYNNP
SNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQE
VEIPIVSHSDCKRAYPGEITSNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVS
FGRGCAEPGYPGVYARVSQYQDWITSSTGSSNPPGFVEFHSSGFRSTSNLFLLSISLTLS
IIPLVSVLSS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaacacagctttgactgttgttggagcattattagtcaacattgcaggttca
ctctgtcagttaaatgtctgtggtcgggcccctcttaacactaaaattgtaggaggacag
aatgcaggagcgggatcttggccgtggcaagtcagccttcagagtcccacctatggaggc
catttctgtggcgggagtctaatcaataaagactgggttctgtctgcagctcactgcttc
caggactccattggtacaattatggtcaaactgggactacagagccagtcaggctcaaac
ccttatcagataaccaagacagtagttcaagtcatcaatcatcctaactataacaaccct
agcaatgacaatgacatagcactggtcaagctcgattcttctgtgactttcaatgattac
attgagccagtgtgtctggctgctgctggaaatacctatgctgctggtacactgagctgg
gtcactggatgggggaaactcagttctgcagccaaccagattcctgacatactgcaggag
gtggagataccgattgtgagccacagtgactgtaaacgtgcgtatccaggcgagatcaca
agcaatatgatttgtgctggattgttagatcagggaggaaaagattcatgtcagggagac
tctgggggtccaatggtcagtaggaatggctcccagtggattcagtctggcattgtgagt
ttcggtcgaggatgtgctgagcccggttatcctggtgtttacgccagagtgtcgcaatac
caggactggattactagttccacaggcagcagcaatccacctggatttgttgaattccat
tccagtggattcagaagcacatctaacctgtttttattgtccatttctctcacattatcc
atcattcctttagtctctgttctctcttcataa

DBGET integrated database retrieval system