KEGG   Danio rerio (zebrafish): 65223Help
Entry
65223             CDS       T01004                                 

Gene name
prss1
Definition
(RefSeq) cationic trypsin-3 precursor
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    65223 (prss1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dre01002]
    65223 (prss1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    65223 (prss1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     65223 (prss1)
Peptidases [BR:dre01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   65223 (prss1)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   65223 (prss1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 PPV_E2_C
Motif
Other DBs
NCBI-GeneID: 65223
NCBI-ProteinID: NP_571783
ZFIN: ZDB-GENE-010131-7
Ensembl: ENSDARG00000042993
Vega: OTTDARG00000021061
UniProt: Q561Z7
LinkDB All DBs
Position
16
AA seq 247 aa AA seqDB search
MKAFILLALFAVAYAAPLGDDDDKIVGGYECTKNGVPYQVSLNSGYHFCGGSLISNLWVV
SAAHCYKSRVQVRLGEHNIDVTEGTEQFINSEKVIRHPSYNSNTLDNDVMLIKLSSSAQI
NSYVKTVSLPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRNAYPGQI
SSNMFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVCNFTTWI
RNTMNSN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcattcttctggctcttttcgctgtggcttatgccgctcctctgggagac
gatgatgataagattgttggtggatatgagtgcactaagaatggtgttccataccaggtg
tctctgaacagcggctaccacttctgcggtggctctctgatcagcaacctctgggttgtg
tctgctgctcactgctacaagtcccgtgtccaggtgcgtctgggtgagcacaacattgac
gtcactgagggaaccgagcagttcatcaactccgaaaaagtcatcagacaccccagctac
aacagcaacaccctggacaatgacgtcatgctgatcaagctgagcagctccgcccaaatc
aacagctacgttaagaccgtctctctgccttcaagctgcgcttcatctggaaccagctgt
ctgatctctggatggggaaacatgagcgccagtggaagcaattacccaagccgtctgatg
tgcctgaatgctcccattttgagcgacagcacctgcagaaacgcctaccctggtcagatc
tcctctaacatgttctgcgctggttttatggagggaggcaaggactcctgccagggtgac
tctggtggcccagttgtgtgcaacaaccagctgcagggtatcgtgtcctggggttatggc
tgtgcccagaggaacaagcccggtgtttacgccaaggtctgcaacttcaccacctggatc
agaaacaccatgaactccaactaa

DBGET integrated database retrieval system