KEGG   Danio rerio (zebrafish): 751629Help
Entry
751629            CDS       T01004                                 

Gene name
kmt5aa
Definition
(RefSeq) N-lysine methyltransferase KMT5A-A
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    751629 (kmt5aa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    751629 (kmt5aa)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     751629 (kmt5aa)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     751629 (kmt5aa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 751629
NCBI-ProteinID: NP_001038814
ZFIN: ZDB-GENE-060825-37
Ensembl: ENSDARG00000105231
UniProt: Q071E0
LinkDB All DBs
Position
10
AA seq 344 aa AA seqDB search
MFPAVNEIKVQTWRRDQRGECPRRSAQCRLFSCAHRECAPAARSLENRGPENRTARPEAT
MSGDVLCNGHSAFHRLLKHSSSRTHEALVVKIIQENKNTPLFCTAPEPRRDSGVNGEFLL
NSAELQDEQTLPLHCIHSAADITSSKHRKPARRKVKRSTKRAAESKSPANRKVTDYFPIR
RSSRKSKSELKYEEKQHIDTLISNGIEDGMMVRFIEGKGRGVFATQPFQKGQYVVEYHGD
LLQITDAKQREALYAQDPSTGCYMYYFQYLSKTYCVDATKESDRLGRLINHSKNGNCQTK
LHAIAGKPHLILVASRDIQEGEELLYDYGDRSKSSIEAHPWLKH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctgccgtgaatgagataaaagtgcaaacatggcggcgtgatcagcggggagag
tgtccgcggaggagcgctcagtgtcggctgttttcctgcgctcaccgtgaatgcgctcca
gcggcccggagcctggagaaccgcggaccggagaaccgcacagcccggccagaggcgacc
atgagcggggacgtcctgtgtaacggacactcggcgtttcaccgcctgctgaagcacagc
agctccagaactcatgaagcgctcgttgtgaagatcatccaggagaacaaaaacacacct
ctgttctgcacagcgcccgagcccaggagagacagtggtgtaaatggcgagttcctcctc
aacagtgcagagctgcaggacgagcagacgcttccactgcactgcatccacagcgctgct
gacatcacttcctctaaacacaggaagccggcccgccgcaaagtcaagaggtccaccaag
agagctgctgagagcaagagtcctgcaaaccggaaggtcaccgattatttccccatcaga
agaagctccagaaagagcaagagtgaactgaagtatgaagagaagcagcacatcgacaca
ctgatcagcaacggcatcgaggacgggatgatggtgcgcttcatcgaggggaagggtcgt
ggggttttcgcgacgcagccgttccagaagggtcagtatgtggtggaatatcacggagat
ctgctgcagatcacagacgccaagcagagagaggctctatacgcacaagacccctccacc
ggctgctacatgtactacttccagtatctcagcaaaacatactgtgtggacgctacgaag
gagtcggatcggctgggccggctcatcaaccacagtaaaaacgggaactgtcaaaccaaa
ctgcacgccatcgccggaaaacctcacctgatcctggtggcttccagagacatccaggaa
ggagaagagctgctgtacgattacggcgaccgcagtaaatcctccatcgaggcgcacccg
tggctcaaacattaa

DBGET integrated database retrieval system