KEGG   Danio rerio (zebrafish): 767665Help
Entry
767665            CDS       T01004                                 

Gene name
galnt10
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 10 precursor
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 767665
NCBI-ProteinID: NP_001070072
ZFIN: ZDB-GENE-030131-595
Ensembl: ENSDARG00000103825
Vega: OTTDARG00000031499
UniProt: Q08CG2
LinkDB All DBs
Position
21
AA seq 261 aa AA seqDB search
MRRRQKRLLRVGLLLSAALLLLLLGSVSLERRLDAEEPEGGAGLAQMQKVNRKQVLKDGV
RKKDWHDYAAIRSDAARTGAGEQGRPYPLTDAERVDQAYRENGFNIFVSDRIALNRSLPD
IRHPNCKLKLYTADLPNTSVIIPFHNEGWSSLLRTVHSVLDRSPPSLIAEIILVDDFSDK
GHLKAPLEQYMVRLPKVRILRTQKREGLIRTRLLGAAAARGQVITFLDSHCEANVNWLPP
LLDRIAQNTNSSVLDSFNQRT
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcaggcagaagcggctgctgcgggtcgggctgctgctctccgcggcgctgctg
ctgctgctgctgggctccgtcagtctggagcgccggctggacgcggaggagccggagggc
ggagcgggactcgcgcagatgcagaaagtgaacagaaagcaagtgctgaaggatggcgtc
cggaagaaggactggcatgactatgcagccatcaggagtgacgcggcacgaacaggtgct
ggagagcagggccggccgtacccactgacggatgcagagcgtgtggatcaggcctacaga
gagaacggcttcaacatcttcgtcagcgaccgcatcgccctcaacagatcactgcctgac
atcagacaccccaactgtaagttgaagctgtacactgcagatctccccaacaccagcgtc
atcatcccgttccacaatgagggctggtcgtctctgctgcggacggtgcacagtgtgctg
gatcgctcgccgccgtcgctcatcgcagagatcatcctggtggacgacttcagtgataaa
gggcacctgaaggctccgctggagcagtatatggtgcgtctcccgaaggtgcggatcctg
cgcactcagaaacgtgagggtctgatccgcaccaggctgctgggggccgccgccgcccgc
gggcaggtcatcaccttcctggactcacactgcgaggccaacgtcaactggctgccgccg
ctgctggatcgaatcgcacagaacaccaacagcagcgtgctggactccttcaaccagcgc
acataa

DBGET integrated database retrieval system