KEGG   Danio rerio (zebrafish): 768131Help
Entry
768131            CDS       T01004                                 

Gene name
setdb1b
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1-B
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    768131 (setdb1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    768131 (setdb1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     768131 (setdb1b)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     768131 (setdb1b)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    768131 (setdb1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 768131
NCBI-ProteinID: NP_001070745
ZFIN: ZDB-GENE-061013-224
Ensembl: ENSDARG00000099021
Vega: OTTDARG00000036853
UniProt: A0A0R4IPA3
LinkDB All DBs
Position
16
AA seq 1214 aa AA seqDB search
MEVDAGLNSGMEMELEPELEEELGVSLDELRKWIEEQVDSSEAVQKRKADLEQLQEWVEQ
REKEVADIDALCSNASESVVQCEALVKEVYSNMGLVYRESSSDDEGGKANPSEVIEIDDD
DDDDVIAVGCLVPPKKSLTQAKDPALKEASAALQRTSQQVQNLAQTVNRTAQSGVTTPVK
TGGPPGQGPLAVPAVFMSSAPRNTPTQPNPNIKQDSIKINMTLLGKKRTKTWHRGTLVAI
KQVGNNLKYKVRFENKGKSLLSGNHVAFEYHPTLERLFVGARVVARYKDGNQVWLYAGVV
AEMPNSKNRMRFLIFFDDGYASYVGLPELYPICRPLKKTWEDIEDASCRDFIEEYITSYP
NRPMVLLKPGQIIKTEWEGTWWKSRVEEVDGSLVKMLFLDDKRSEWIYRGSTRLEPMFNL
KMNTANSQEKKMAGQQRQRPNMGALRTKGPVVQYTSDNSAAASTGGGAATPGTPTRPVAP
QPAGPPQPSRTESPSFKSQMAKKSTGQLALQPRQGMPSDLQPKPIINALQTNTSRLFLLQ
SGPVHTLTPITPAPQTVQTAISTYTNERVPQEPSYQAPNDRLFYLTHNCSPECLKRIRPT
RPNLHRGRNPLLTPLLYEFRRMTGRRRLNRKMSFHVIYKSPCGLSLRNMTEIQRYLFQTQ
CDFIFLEMFCLDPYVLVDRRFQPQRPFYFIRDITSGREDIPLSCVNEIDNTPPPSVAYSK
ERIPEDGVYINTSADFLVGCDCTDGCRDKSKCSCHQLTLQATGCTPGGQINPNAGYHYKR
LDECLPTGIYECNKRCRCNMQMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFV
CIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESEAHCSDSEGSGVDMSRV
KLPASSRHGKSNKMEERNSSTTGKSQDDSSEESDDEKDDDSNEDDSDSSDDTFVKDTYYT
TSSVWRSYTTRRQAKGLKEESQDSKDGMSVSAGEDRKPPHMPEETGKSKVASWLTNQSST
SANQSVKVEGGIKTEKKDVMTLSDSDDVQTISSGSDDNKEREKKTQAVVKRQVAVKSTRG
IALKSHSMMVKSGGGGAGGGGSGPSHGHGGGGGDNGPKNTRLFFDGEESCYIIDAKLEGN
LGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKEL
LCCCGSTECRGRLL
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggatgcaggtttaaactcagggatggagatggagctggaaccagagttggag
gaggagttaggagtgtctttggatgagctgcgcaagtggatcgaggagcaggtggacagc
agcgaggctgtgcagaagaggaaagctgatctggagcagctgcaggagtgggttgagcag
cgtgagaaggaggttgctgatatcgatgctctttgctccaatgcctcagagtctgtggtt
cagtgtgaagctctggtgaaggaagtgtacagtaacatgggtttagtgtatcgtgaaagc
agctcagatgatgagggaggcaaggcaaacccttctgaggtcattgagatcgatgatgat
gatgacgatgatgtcattgctgtgggatgtttggttcctcccaagaagagtttaactcaa
gccaaggacccagcgcttaaggaggcttcagctgcccttcaaagaacatctcagcaggtg
cagaacctggctcagactgtcaacagaacggcccaatcaggggtcactacaccagttaaa
acagggggccctcccggacaaggtcctctagctgttccagcagtgtttatgtcctcagcc
ccaagaaacacgcccactcaaccaaaccctaatataaaacaggacagtatcaagataaac
atgacgcttttgggtaaaaaacgaaccaagacgtggcatcgtggaacacttgttgccatc
aaacaagtgggcaacaatcttaagtacaaagtcaggtttgaaaataaggggaagagtctt
ctctctgggaaccatgtggcctttgagtaccacccaacactagagagactgtttgttgga
gcccgagttgttgccaggtacaaggatggtaatcaagtctggctgtatgcaggcgtagtc
gctgagatgcccaacagcaagaaccgtatgaggttcctgatcttttttgatgatggttat
gcctcatatgtgggcttgcctgagctctaccctatctgcagaccattgaaaaagacctgg
gaggatattgaggatgcgtcctgcagagatttcattgaggagtatatcacatcatatcct
aacagacccatggttttactgaagccagggcaaattataaaaactgaatgggagggaaca
tggtggaagagccgtgtggaagaagtggatggcagccttgtgaaaatgctcttcctggat
gataagcgaagtgaatggatttatcgtggctccacacgactagaacccatgtttaatctg
aaaatgaacacggctaacagtcaagaaaagaaaatggctggtcaacaaagacagcggcct
aatatgggagcactgaggacaaagggccctgtagttcagtacaccagtgacaatagtgct
gccgcatctactggtggtggtgccgcaactcctggcactcctactcgtcctgtagcccca
cagcctgctggacccccgcaaccgtcccgcacagagagtcctagttttaagagtcaaatg
gctaagaagagcactggtcaactcgcactgcagcctcgtcagggcatgccctctgacctt
cagcctaaaccaataatcaatgctcttcagaccaatacatccaggctcttccttttgcag
tctggacccgtgcacacgttgacaccaatcacaccagcccctcaaactgtgcagacagct
atttcaacctacacaaatgagcgcgtaccccaggagccgtcataccaggccccaaatgac
cgactcttctaccttacacacaactgctccccagaatgtcttaagcgcatcagacccacc
cgtccaaacctgcatcgaggacgcaacccactccttacaccattgctctatgaatttcgc
cgcatgactggccgcagacgccttaaccgaaagatgtcattccacgtcatctacaagtcc
ccgtgtggcttgagtctaaggaatatgacggagatccagcgctacctcttccagactcaa
tgtgacttcatcttcctggagatgttctgtctggacccctatgtgctggtggaccgccga
ttccaacctcagaggcccttctacttcattagagacatcacgagtggtcgtgaagacatt
cccctgtcctgtgtgaatgagattgacaacacgccaccacccagcgtggcctatagcaaa
gagaggatcccagaagatggagtatatattaataccagtgcagacttcctggtgggctgt
gactgcaccgatggatgcagagacaaatccaagtgctcgtgtcatcagctgactctacag
gctacaggatgtactccaggtgggcagatcaaccccaacgctggataccattataagaga
ctggatgaatgtctccctacagggatctatgaatgtaataagcggtgccgctgtaatatg
cagatgtgcactaatcgtctggttcagcacggtttgcaggtcagactgcagctctttaag
acccagaataaaggctgggggattcggtgtcttgatgacatcgccaagggctcctttgtt
tgcatctatgcaggaaagatcctgacagatgactttgccgataaagaaggtttggaaatg
ggcgatgagtattttgccaatctagaccacattgagagcgtggagaactttaaggaaggt
tacgagagcgaagcccactgctcggacagcgaaggcagcggtgtggacatgagcagagtt
aaactacctgcttcctcccgacacggtaaatccaacaagatggaggagcgtaacagcagc
acaactggcaaaagccaagatgattcctctgaagagagcgatgatgaaaaagatgacgac
tccaatgaggacgatagcgacagctcggatgacacttttgtgaaagacacatattacacc
accagttcggtgtggaggagctacaccactcgcagacaggccaagggattgaaggaagag
agtcaagacagcaaggatggaatgagtgtttctgcaggtgaggacagaaagcctccacac
atgccagaagagactggcaagagcaaagtggcatcttggctcactaaccagtcctctact
tctgccaatcagagcgtcaaggtggagggaggaataaagactgaaaagaaggatgtgatg
actctctccgacagtgacgatgtgcaaactatcagctcaggatcagatgacaataaggag
agagagaaaaagactcaggctgtggtgaagaggcaggtggctgtgaagtccacacgtggc
attgctttgaagtcccacagtatgatggtgaaatcaggtggagggggtgcaggaggcggt
gggtcaggcccgtctcacggccatggaggaggaggtggagacaatggccctaaaaacacc
cgcctgttctttgatggggaggaatcctgctacatcattgatgccaaactagagggcaac
ctcggacgctacctcaaccatagctgcagccccaatctgtttgtccagaatgtgtttgtg
gacactcacgacctgcgctttccctgggtggccttctttgctagcaagcgaatccgagca
gggacggagctgacgtgggactataattatgaggtaggcagtgtggagggcaaggaactt
ctgtgctgctgtggatcaacagaatgcagaggacgactgctgtaa

DBGET integrated database retrieval system