KEGG   Danio rerio (zebrafish): 777612
Entry
777612            CDS       T01004                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04141  Protein processing in endoplasmic reticulum
dre04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    777612 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    777612 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    777612 (atf6b)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    777612 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 CENP-H EMP24_GP25L DUF3035 bZIP_Maf
Other DBs
NCBI-GeneID: 777612
NCBI-ProteinID: NP_001071188
ZFIN: ZDB-GENE-061103-166
Ensembl: ENSDARG00000101369
UniProt: A0JMK4
LinkDB
AA seq 673 aa
MTAELLLSEPDSRFCADNLLTSADWDACLYQCEDMEEEYTGELKYDTSLDSDLVLTLDPD
DLTSPWKNLELDLTGDLSILRDEATVTQPLPVDMFFQVKTEPPSPASSLTSDSSIPAVCE
SQVMVKSENPPTPPYMYGDVLAPPLAGVEVTVASAPQPAVPLSAHTHTTVLSPAATLKAS
SIVSSKPLLQPKPVCVTALPVAPSATAAKALILQSVPVPVPVPTLEQSSTPVVLSPSVCL
APAPAIVKMEPLSPSMPHCSSPSAPQSKPIVPATAAALPGNIGSDIDMKVLKRQQRMIKN
RESACQSRKKKKEYLQNLETQLRDAQQENERLRRENHTLRLRLAGKEATESGSNKRAVCV
MILFLFITFTFGPVSLKERPLEAELQEAAMPLTGRHLLEFEGSQMRRNRRMEKKTEPEDG
GEEEEWRRTEAEKEEALAYQFRNQSGVFSDVKDLLLQDIDRYFSSSDCRQFNRSESLRLA
DELRGWVHRHQINRKSDGKPKAVKKTKIAQKAQHKKMNFSRYLPIQTHRSIESQLQVLPG
PEISYSDFLDAIDRREDTFYLVSFRRDHLLLPAISHNKTTRPKMSLVMPAMAINDSVYNA
SQSGYEMMMQVDCEVMDTRIIPIKSSVVPPSLRDPPPAPPTHHHHGNHTSLRSRNQHPSR
RRPAGYFISQSGD
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgaccgcggagctgctgctgtcggagccggacagccgcttctgcgccgataacctgctg
accagcgcggactgggacgcctgcctgtaccagtgtgaggacatggaggaggagtacaca
ggagagctgaaatacgacacatcgctggacagtgatctggtcctcacgctggaccctgat
gacctcacatccccatggaagaacctggagctggacctcacaggagatctgtccatcttg
agggatgaagcgactgtaactcagcctctgccggtggacatgtttttccaggtgaagaca
gagcctccatcaccagcctcatctctgacctctgacagctccataccggctgtgtgtgaa
tcgcaggtgatggtgaagtcagagaatcctccgacgccgccgtacatgtatggagatgtg
ctggcgcccccgctggccggagtggaggtgacggtggccagcgctccacagcctgctgtt
cctctcagtgctcacacacacaccacagtgctgtctcctgcagcgacactgaaggccagc
agtatagtcagcagtaagcctctgcttcagcccaaaccggtgtgtgtgacggcgctgccc
gtggccccgagcgcgactgcagctaaagcgctgatcctgcagagcgtacctgtacctgta
cctgtgcccacgctggagcagagcagcacacctgtggtcctctctccgtccgtgtgtctg
gcccctgctcctgctattgtaaagatggagccgttatctcccagcatgcctcactgcagc
agcccgtcggcgccgcagagcaaacccatcgtcccggcgacagcagctgcacttcctgga
aacattggcagtgacatcgatatgaaggttctgaagaggcagcagcgcatgatcaagaac
cgtgagtctgcatgtcagagccgcaagaagaagaaggagtacctgcagaacctggagaca
cagctgagagatgcacagcaggagaacgagcgcctgcgcagggagaaccacacactcaga
ctgagactcgctgggaaagaggctactgaatctggcagcaataagagagccgtgtgtgtg
atgatactgttcctgttcatcaccttcaccttcggccccgtcagtctgaaagagcgcccc
ctggaggccgaactgcaggaagccgcgatgcctctgacaggaagacacctgctggagttt
gagggatctcagatgcgcagaaacaggaggatggagaagaagacggagccggaggatgga
ggagaggaggaggagtggaggaggacagaggcggagaaagaggaggcgctcgcctatcag
ttcaggaatcagagcggtgtgttcagtgatgtgaaggatctgctcctgcaggacatcgac
aggtacttctcctcctcagactgcagacagttcaaccgctccgagtccctgaggctggcg
gatgagctgcgcgggtgggttcacagacaccagatcaacaggaagtctgacgggaaaccc
aaagctgtgaagaagactaaaatagctcagaaagctcagcacaagaagatgaacttctcc
aggtatctgcccattcagacgcatcgctccattgaaagtcagctgcaggtgctgccgggt
cctgagatcagctacagcgacttcctagacgccatcgaccggcgagaggataccttctat
ttggtgtctttcagacgggatcacctcctcttacccgccatcagccacaacaaaaccact
cgacccaagatgtctctggtcatgcctgctatggccatcaatgattcggtctacaacgcg
tctcagagcggttatgagatgatgatgcaggtggactgtgaggtgatggacaccaggatc
atccccatcaagtcttctgtagtcccgccctctctcagagacccgccccctgccccgccc
actcaccatcaccatggcaaccacacctcgctccgcagccggaaccaacatccgtccaga
aggagaccagcaggatacttcatcagccagagcggagactag

DBGET integrated database retrieval system