KEGG   Danio rerio (zebrafish): 791729Help
Entry
791729            CDS       T01004                                 

Gene name
rh50
Definition
(RefSeq) Rh50-like protein isoform 2
  KO
K06580  ammonium transporter Rh
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    791729 (rh50)
   04090 CD molecules [BR:dre04090]
    791729 (rh50)
Transporters [BR:dre02000]
 Solute carrier family (SLC)
  SLC42: Rh ammonium transporter
   791729 (rh50)
CD molecules [BR:dre04090]
 Proteins
  791729 (rh50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp
Motif
Other DBs
NCBI-GeneID: 791729
NCBI-ProteinID: NP_001119916
ZFIN: ZDB-GENE-000427-1
Ensembl: ENSDARG00000041848
Vega: OTTDARG00000020419
UniProt: B0UYU0
LinkDB All DBs
Position
8
AA seq 472 aa AA seqDB search
MKKNSTNLRLRLPALIFASEVVIVVLYACFVTYDDHANALLQNNQTRHMENSFYQNYPFF
ADIQVMIFIGFGCLLAFFRRYGFGGMVFNFLVATFTIQWAILIQGFFQFFYDGKIHLSVL
NLINAEFACAVVLISFGAVLGKTSPVQLLIMALLEIPLFGVTEWAVLKYLRINDAGGSIL
IHIFACYFGLGVTFVLYRPSLNEGHPKVSTSYQSDLLSVMGTLFLWVFWPSFNSALTFKG
DDQHRAVLHTFIGLSASTITAFALSSMLSKNGKISMADVQNVTLAGGVTVGASVDMMISP
AAAYVLGVMGCFACMLGYKYLSPVLAQKLRIQDQCGIHNLHGLTGLISSLAGICAILLAT
EETYGPSLYETFSHQAPPEGDPQLMELQQLIPDLEAGLGRSAKEQALFQVAALFGTIAVS
AVGGMLTGVVLKLPFLASPSDEQCFDDEVFFTVPSDYDCVNVLSETRKAENE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaattccacaaatttgcgattacggctccctgctctaatttttgcatcagag
gttgtgattgtggtcctctatgcttgctttgtgacctatgatgatcatgctaatgcactt
ctacaaaacaaccagacacggcacatggagaattcattttatcaaaactatccgtttttt
gctgacattcaggtgatgatatttattggatttggctgccttctggcctttttccgacgc
tatggctttggtggaatggtttttaattttttagttgctacattcaccattcagtgggca
attctgattcaaggattctttcagtttttctatgatgggaagattcatcttagtgtgctg
aacctgattaatgccgagtttgcttgtgctgttgtgctcatctcatttggagccgtgttg
ggaaagacgagccctgtgcaactcttgatcatggccttgctcgagatccctctgtttggt
gtcacagaatgggctgtactgaaatacctgaggatcaatgatgctggtggctcgattctt
atccacatttttgcctgctactttggtctgggtgtcacatttgtcctgtatagaccaagc
ctaaatgaaggacacccaaaggtgtccacaagttaccaatcagatctgttatctgtaatg
ggaaccctgttcctctgggtgttttggccatctttcaactcagcgctgaccttcaagggt
gacgaccagcaccgagccgttctgcacacatttataggtctcagtgcctcaacaattact
gcttttgccctgtccagcatgctaagtaagaatggtaagatcagcatggctgatgtgcag
aatgtaacattggctggaggtgtaactgtcggcgcctcagtggacatgatgatttcaccg
gctgctgcttacgttctgggagtcatggggtgcttcgcgtgcatgctggggtacaaatac
ctaagcccagtcctggcacaaaagctgcgaatacaggatcagtgtggcatacataacttg
catggactaaccggactcatttccagtcttgcaggaatctgtgccatcctgctggcgacc
gaggaaacatacggccccagtctttatgagactttctctcatcaagcacctcctgaagga
gaccctcagctcatggagttacaacaattgatcccggatctggaagcaggcttgggcaga
agtgcaaaggaacaggccctctttcaggtggctgcactgttcgggaccattgccgtgtct
gcagtaggggggatgctgactggtgtagttctcaagctaccatttttggcttcaccctca
gatgagcaatgctttgatgatgaggtcttctttactgttccttcagattacgactgtgta
aatgttctcagtgaaacaaggaaagctgagaatgaatga

DBGET integrated database retrieval system