KEGG   Danio rerio (zebrafish): 794088Help
Entry
794088            CDS       T01004                                 

Gene name
ptena
Definition
(RefSeq) phosphatase and tensin homolog A
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
dre04068  FoxO signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04115  p53 signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04218  Cellular senescence
dre04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    794088 (ptena)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    794088 (ptena)
   04070 Phosphatidylinositol signaling system
    794088 (ptena)
   04150 mTOR signaling pathway
    794088 (ptena)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    794088 (ptena)
  09143 Cell growth and death
   04115 p53 signaling pathway
    794088 (ptena)
   04218 Cellular senescence
    794088 (ptena)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    794088 (ptena)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dre01009]
    794088 (ptena)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     794088 (ptena)
    3.1.3.48  protein-tyrosine-phosphatase
     794088 (ptena)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     794088 (ptena)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    794088 (ptena)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 794088
NCBI-ProteinID: NP_957002
ZFIN: ZDB-GENE-030131-3776
Ensembl: ENSDARG00000071018
Vega: OTTDARG00000020224
UniProt: Q6PC66
LinkDB All DBs
Position
17
AA seq 454 aa AA seqDB search
MAMTAKLKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLD
SKHKNHYKIYNLCAERHYDASKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENH
VAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYY
SYLLKNKLDYKPVALLFHKMVFQTLPMFSGGTCRDSTVKNRSEVNPQGFKKGSWHWDPQF
VVYQLKVKIHTSNPAHTRREEKHMIFEFPQPLPVCGDIKVEFFHKQSKMMKKDKMFHFWI
NTFFIPGPEEAGDKVENGSVVNDVDSLSCQSQSSPAERDREKERAVAAAALDRERGGERA
DGEKDYLILTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNSEASTSTSVTPDV
SDNEPDHYRYSDTTDSDPENEPFDEEQHAQITKV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgactgctaaactaaaagaaatagtcagtcggaataagcggaggtaccaggag
gatggatttgatttggacctcacttacatataccctaacatcattgccatgggctttcca
gccgaacgattggaaggtgtttaccgaaacaacattgatgacgttgtccggtttttagat
tccaagcataagaatcattataaaatttataatctatgtgctgaacgacactacgatgca
tctaaattcaactgtagagtggcacagtatcccttcgaggaccacaaccctccacaattg
gaattaataaagcccttctgcgaggatctcgaccagtggctgtccgaggatgagaaccat
gtggctgccatccactgcaaggcaggcaaaggtcgcacaggtgtcatgatatgtgcctat
ctgctgcatcgcaagaagttcgcagaggctcaagaggcactggacttttatggggaagtc
agaaccagggataaaaagggggtgacaattcccagccagcgcaggtatgtgtattactac
agctacctgctgaagaacaagctggactataaacccgttgccctcctcttccataaaatg
gtgttccagactttgcccatgttcagtgggggcacctgcagggacagtactgttaaaaac
aggagtgaggtgaatccccagggcttcaagaaaggcagctggcactgggaccctcagttc
gtagtgtatcagttgaaggtaaagatccacacgtcaaatccagcccacacgcgaagggaa
gagaagcacatgatcttcgagtttcctcagccgcttccggtttgtggcgacatcaaggtg
gagtttttccacaagcagagcaagatgatgaagaaggataaaatgtttcatttttggata
aacacgttcttcatcccggggcctgaggaagcaggggacaaagtggagaacgggtcggtg
gtgaacgacgtggacagcctgtcgtgtcagagccagagttcaccggcggaacgggacagg
gagaaggagagagccgtcgcagcggctgcactcgacagagaaagaggaggagagcgagcg
gatggggaaaaagactacttgattttgaccttaacgaagaacgacttggataaagccaac
aaagataaggctaaccgatatttttcacccaactttaaggtcaaattgtatttcaccaag
accgtggaggagccctcaaactcagaagcaagcacttcaacttctgtcactccggacgtg
agtgataatgaacccgatcactaccgttattcagacaccactgattctgacccggaaaat
gaaccttttgacgaggaacagcacgcacagattacaaaagtctga

DBGET integrated database retrieval system