KEGG   Danio rerio (zebrafish): 796436Help
Entry
796436            CDS       T01004                                 

Gene name
lct
Definition
(RefSeq) lactase-phlorizin hydrolase isoform X1
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00052  Galactose metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    796436 (lct)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     796436 (lct)
    3.2.1.108  lactase
     796436 (lct)
Chaperones and folding catalysts [BR:dre03110]
 Intramolecular chaperones
  Others
   796436 (lct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase ATG7_N
Motif
Other DBs
NCBI-GeneID: 796436
NCBI-ProteinID: XP_021334700
ZFIN: ZDB-GENE-081104-434
Ensembl: ENSDARG00000092404
LinkDB All DBs
Position
9
AA seq 1898 aa AA seqDB search
MMKILGVFLSLGVLAIFWSYSNADEQEFMLLAGPLTTSKTLHLEEQYVFNCGGPLPQQSK
DYFLYLQRRGVTNFKVPLSWSHILPTGDANQPHEETVMCFKTLVQQLTESGIKPLLVLHR
SAVPELFRAKYGGWENPLLVQMFEQYAGFVFSTFRDHVDTFVTFSHLHELQDRQLKNALQ
SHENAYKVCHQRFTGLRLSLGIKASDVTSIHQMGSKIKTHVDFLSVHMQFNCKMQTALTE
ELRKVQIVSGQKSLLIYQLTVNDCDGYEHGFEARTGILGVLQNEGHHIIGCDITYVFEEL
DYEETLSLQKENTKIHQKSASAFSYQKVWEKFKSQTEAERDQFLSGSFPVDFQWSVSSES
FKVEGGSAEHGKGETIWDRFNHEAGVNESILGCDSYHKVDYDVYLLRGMMAPNYQFSISW
ARIFPTGRKESFVEKGAAYYDKMINTLLQSGIEPTVTLHHWDLPQALQESGGWTNDSIVE
AFKEFSDFCFSRYGDRVKSWITFGSPWVVSSLGYGTGEYPPSIKDPVSASYKVTHNILKS
HAEAWHIYNDKYRKLYGGKVGIALNSDWAEPRDPSSDQDVAAAERYLNFMLGWFAHPIFV
DGDYPAVLREQIEKKKELCTQDLARLPVFTEAEKQRIRGTADFFGLNHQTSRLISENLTS
CDAGPDNVGDFQAHIDPTWPTTASDQIQSVPWGLRRLLYYIFLEYTSITKVPIYITGNGM
PTEYTGDGINDTLRVDYLKAYINEAMKAVHLDDVVVQRFTVQSLMDGYEGPPGYTQRFGL
HYVNFDDPDRPRTPKASAYYYSKVIERNGFAETAASPKMHIRGNQVESRRLPSLPPSQVP
SKSKVVWEKFSPQTKFERQLYHYGTFSEGFQWGVSSSAYQVEGGWNADGKGPSVWDTFTQ
KPGNIPNNANGDVACDSYNKVDEDLHMLRALKVKTYRFSLSWSRIFPNGYKSSLNQKGVD
YYNRLIDGLIANNITPMVTLYHWDLPQALQNINGWDNTEMVSIFNEYCDFCYATFGDRVK
FWITFNEPQTIAWLGYGLGQIPPNVKQPGDAPYRVAHNLLKAHAQAYHTYDEKYRASQGG
LVSISLNAEWAEPLDVNIPREVEAADRALQFQLGWFAHPIFKNGDYPDAMKWQVGNKSEL
QGLKESRLPSFTSQDKAFIQGTADVFCINTYTTKVMRHVTSRLNIESYQTDQDIEKDNAD
SYEDTAVSEQKAVAWGLRRLLIWLKEEYGNPEIYITENGVATSTAFTTDDTDRIFYLKTY
VDEALKAHNLDGVRVKGYIASSLMDSFEWLNGYNVGYGLHHVDFKHSSRPRTPKRSAHFY
FDIIRNNGFPITAEEEILYGHFREGFEWSTATAAYQIEGAWRADGKGLSIWDKFSHTDSK
ITQDDNGDIACDSYNKIEEDINVLKTLGVKHYRFSISWPRILPDGTNRKINEAGLDYYHR
LTDALLAANIKPQVTLYHWDLPQALQDVGGWENDTIVDRFRDYADVVFNSLGEKIKFWIT
LNEPLNVAAHGYGYGSQAPGLSDSPGTAPYTVAHNLIKAHAEAWHLYNDQYRAKHGGMIS
LTMNSDWAEARNPYKQEDVDAARRTIQFQLGWFAHPVFKGDYSDLMKDVIRERSLAAGLP
KSRLPEFTPEEVARIKGTHDYFGFNHYTSVLAFNVDYGDQQHIEADRGAGAIRDRTWLDS
GSIWLKVAPVGFRKILNFIKEEYGNPPLYITENGVSEQGPENLNDVTRIYYYENYINQAL
KAYMLDGVDIRGYTAWSLMDNMEWAAGYTERFGLFYVNRSDPNFPRIPKKSVWSYATIVS
CNGFLSPEERPHKCEVHEPEDDIPGITTLPPPVEELSVSFLGLEVSVSNAELGLNVLFSL
TFIAAVTVIFLVFGLVRTSKKQRRPAGEHIELAKEDKF
NT seq 5697 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagatcctaggggtatttctgtctctgggtgtgttggctattttctggagctac
agtaatgcagatgaacaggagttcatgctacttgcgggccctctgaccaccagcaagact
ttacatttagaggaacaatatgtgtttaactgtggaggtccactgccacagcaatccaaa
gactacttcttgtaccttcaaaggagaggggtgaccaacttcaaggttcccctgtcttgg
tctcatattcttcctacaggtgatgccaaccagccacatgaagaaactgtgatgtgcttt
aagacacttgtacaacagctgactgaatcaggcatcaaacctctgctggttctccatcgt
tctgcagtaccagaactcttcagagccaaatatggaggatgggaaaatccattgctagtg
cagatgtttgagcagtatgcaggatttgtgttcagcacatttagggatcacgttgacacg
ttcgttacattcagccacctgcatgagctacaagatagacaactaaaaaatgctctccag
tcccatgaaaatgcttacaaagtctgccatcaaaggtttacagggcttcgtttatctctt
ggaatcaaagccagtgatgttacttccattcatcaaatggggtcaaaaatcaagacacat
gtggatttcctctcagtgcacatgcagttcaactgcaaaatgcagacagctcttactgag
gaattgagaaaggtacagattgtcagcggtcaaaagtccctgcttatttatcagctgaca
gtgaatgattgtgatggatatgaacatggttttgaggcacgtactggaattcttggagtt
ttacagaacgaaggccatcatattataggctgtgacatcacatatgtttttgaggagcta
gattatgaagaaacactcagtctgcagaaggaaaacactaaaattcatcagaaatcagct
tctgcattctcatatcagaaggtttgggagaaattcaaaagtcagactgaagctgagcgg
gatcagttcctcagtggttccttcccagttgattttcaatggtccgtctccagtgagagt
ttcaaagtcgaaggtggatcagcagaacacgggaagggtgaaaccatatgggaccgtttt
aaccatgaggccggggtcaacgaatccattttgggctgtgatagttatcacaaggtggac
tatgatgtgtatcttcttagaggcatgatggcaccaaattatcagttctcaatctcttgg
gctcgcatttttcccactggacgcaaagaaagttttgttgaaaagggggctgcttattat
gataagatgattaatacactcctgcaatcaggaatcgagcccactgttaccctgcatcat
tgggaccttccccaagctctacaggaatcaggaggctggactaatgactccattgtggaa
gcattcaaagaattttcagacttctgcttctctcgttatggagacagagtaaaatcatgg
atcacctttggcagtccctgggttgtgagcagtttgggatatggaacaggggaatatcct
ccaagcattaaagacccagtatcggcctcctacaaggtgacgcacaatattctgaaatct
catgctgaagcctggcatatttataatgataaatacaggaaactgtatggtggaaaagtg
ggcattgctctgaactcagattgggctgagccgagggatccctcaagtgatcaggatgta
gcagcagctgagcgttatctaaacttcatgctggggtggtttgctcatccaatatttgta
gatggagattatccagcggtactgagggagcaaattgagaaaaagaaagaattgtgtacc
caagacctggcaagactccctgtcttcaccgaggctgagaaacaaagaattcgaggcaca
gctgatttcttcggactaaaccaccaaacatcccgactgattagtgagaatttgactagc
tgtgatgctgggccagataatgttggggacttccaggctcatattgaccctacatggccc
actacagcttctgaccagatccagtctgttccatgggggctccggcggttattgtattac
atctttttagagtacacatctattacaaaggtgcccatctatatcacaggaaatggaatg
ccaactgagtatactggtgacgggatcaatgacactctgcgtgttgactatctcaaagct
tacattaatgaagcaatgaaagctgtgcatttggatgatgttgtcgttcagaggtttaca
gtccagtctctaatggatggatatgagggtcctccaggttacactcaacggtttggtttg
cactatgtgaactttgatgatcctgacaggccaagaacccctaaagcatcagcatactat
tactcaaaggtgattgagagaaatggatttgctgagactgctgcaagccctaagatgcat
atccgtggaaatcaagtcgaaagtagaagactccctagtttgcctccatctcaagtgcct
tcaaaatccaaggttgtttgggaaaagttttcacctcagaccaaatttgagaggcagctt
tatcactatggaacattttcagagggatttcagtggggtgtctcatcttcagcttatcaa
gttgaaggtggctggaatgcagatggaaaaggaccaagtgtttgggatactttcactcag
aaacctggtaatatcccaaacaatgccaatggcgatgttgcatgtgatagctacaataaa
gtagatgaagatctacacatgttgagggccctaaaagtgaagacttacagattctcattg
tcatggtctcggatctttccaaatggctataaatcttctcttaaccagaagggggtggat
tactacaacaggctcatagatggtctcatagcaaataatatcacacccatggtgactctc
taccattgggacctgccgcaggctttacagaatatcaatggttgggacaacactgaaatg
gttagcatattcaatgaatattgtgacttctgctatgcaacatttggagatagggtgaag
ttttggatcacctttaatgaaccccagacgattgcatggttgggatatgggctgggtcag
attccacctaatgtgaagcaaccaggagatgctccatacagggttgcacacaacctcctg
aaagctcatgcacaagcttatcacacatatgatgagaaatacagggcatctcaaggaggt
ctggtatccattagtctgaatgctgaatgggcagaacccctggatgtcaacatccctcga
gaggtggaggctgctgatcgagctcttcaatttcaattaggctggtttgcacatccaatc
ttcaagaatggtgactaccctgatgccatgaagtggcaagttggcaacaagagtgaactg
caaggcttaaaagaatcccggttaccttcttttactagccaagacaaagcttttatccaa
ggaacagctgatgtattctgcattaacacatacactacgaaagtcatgcgccatgtgacc
agcagacttaatatcgaatcctatcagactgatcaggacattgagaaggacaatgcagat
agctatgaagatacagctgttagtgagcagaaagctgttgcttggggactcaggagactt
ctcatttggttgaaagaagagtatggaaatcctgagatttatattacggaaaatggtgta
gctacaagcactgcctttacaacagatgacactgatcgtatattctatttaaagacctat
gttgatgaggctcttaaagcgcacaacctggatggagtacgtgttaaaggatacattgct
agttcactcatggactcctttgagtggctgaatggctacaatgtcggctatggacttcac
catgtggactttaagcattcaagtcggccaagaaccccaaagcgctcagctcacttttac
ttcgatataataagaaataacggctttccaatcacagcagaggaagaaatactatatgga
catttcagagaaggatttgaatggagcacagcaaccgctgcatatcagatagagggcgcc
tggagagctgacggaaaaggcctaagcatttgggacaaattttcacacactgattcaaag
ataacgcaagatgataatggtgacattgcctgtgacagctacaacaagatcgaagaggat
atcaatgttctcaaaacacttggggtcaaacattatcggttttctatttcatggcccaga
attctgccagatggaacaaacaggaaaattaatgaggctgggctcgactactatcataga
ctgacagatgctcttttggcagccaatatcaagccacaggtgacactttaccactgggat
ctgccacaagctcttcaggatgttggtggttgggagaatgacactattgttgatagattc
agagactatgctgatgttgtatttaacagtctgggtgaaaaaataaagttttggatcact
ttaaatgaacccctaaatgttgcagcacatggatatggctatggaagccaagcaccaggt
cttagtgatagtccaggcactgcgccatatactgtggcacataacctcattaaggctcat
gctgaagcttggcatttgtataatgaccaatatcgtgctaaacatggtggaatgattagc
ctcactatgaactccgactgggctgaagcaagaaacccatacaaacaagaagacgtggat
gctgccagacgtacgattcagtttcagcttggttggtttgctcatcccgtgttcaaagga
gattacagtgatttaatgaaggatgttattcgagaaagaagtttggcagctggcctacct
aaatcaaggcttccagaatttacccctgaagaagtagcaagaattaagggtactcatgat
tattttggattcaaccactacacctctgttttagcctttaacgtggactacggtgatcaa
cagcacattgaagcagacaggggtgctggagctattagggatcgtacatggctagattct
ggatccatctggttgaaagtagctcctgtgggattccgaaagattctgaatttcattaag
gaggaatatggaaaccctcctctttacattacagaaaatggagtatcagaacaaggacca
gagaatctgaatgacgtcacccgaatctactactatgaaaactatatcaatcaggccctg
aaagcatatatgctagatggtgtggacatccgcggctacactgcctggtcactaatggac
aatatggaatgggcagcgggttatactgaaagatttggtcttttctatgtaaatcggtca
gatcccaattttccacgtattcctaagaaatctgtctggagctatgctacaattgtcagc
tgcaatggcttcttaagcccagaagaacgtccacataaatgtgaggtgcatgaacctgaa
gacgacatcccaggaatcactactttacctccacctgttgaggaactgtcggtcagtttc
ttgggtttggaagtgtctgtttctaatgctgaactaggtcttaatgtcctcttcagtctc
accttcatcgctgccgtcactgttatcttcttggtgtttggacttgtcaggacatccaaa
aaacaaagacgtcctgcgggggaacatattgagcttgcgaaagaagacaagttctaa

DBGET integrated database retrieval system