KEGG   Danio rerio (zebrafish): 796461
Entry
796461            CDS       T01004                                 

Gene name
nrg1
Definition
(RefSeq) pro-neuregulin-1, membrane-bound isoform isoform 1
  KO
K05455  neuregulin 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    796461 (nrg1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    796461 (nrg1)
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    796461 (nrg1)
Cytokines and growth factors [BR:dre04052]
 Growth factors
  Growth factors (RTK binding)
   796461 (nrg1)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   796461 (nrg1)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set C2-set_2 EGF_2 EGF V-set_CD47 hEGF Cyt_b-c1_8
Other DBs
NCBI-GeneID: 796461
NCBI-ProteinID: NP_001038376
ZFIN: ZDB-GENE-050302-113
Ensembl: ENSDARG00000104314
Vega: OTTDARG00000019703
UniProt: B3DK99
LinkDB
Position
10
AA seq 599 aa
MAEVKAGKEGKSGDKKKDKESVRSNKPDNSPQAEPKLKNLRSVTVEDGKKTVLKCEILAG
NPAPNVKWYKNGKELTGKNKPKSIKIKKKKQGKISELLIRKSTEGDAGLYTCEAVNSLGK
TNTTANLFIINTATSTTPSAKTSSHVTPCNESEKEYCVNHGKCFTLEVTPGNIRRLCRCP
PGFTGNRCQNRDPVRVVDHKQAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKK
LHDRLRQSLRERNAAAKGPQHPHPPPENLQLVNHYMPTNPVPAHMTDKEAETSLSTNEFT
SPTHPSTAITHSSSQCWSNGKAESVVSDSHAVLMKPSAENCQHGTPSHRGRLNATGGVHQ
LNDYLKNSREAQGSNRDSPYSERYVSAMTTPTRLSPVGLLSPVTPSSPPSEMSAPLSSLA
TSVPSMLTSPSGEEERPLLFRTPPILRDKSASTQGRKSGHNLRNSAHYNHGLDIPSPPPS
PLHIEEEIDCLEQYKSTSVPSSAPHSPSAARTQPSGQAAPEQAVSGSNSESSSSESETED
ERVGEDTPFLGLQNPLAAGSLVLDGLEGSRTNPALHLSPQHELQNRLTAVMANQDPIAV
NT seq 1800 nt   +upstreamnt  +downstreamnt
atggctgaggtgaaagcaggcaaagaagggaaaagtggcgataagaaaaaggataaggag
tctgtgagatcaaacaagcctgacaactctccgcaagcggaaccgaagttaaaaaacctt
cggagcgtgacagtggaggacgggaaaaaaacggtactcaaatgtgagattttggcagga
aacccagcgcccaatgtcaagtggtacaagaacggaaaagagctcacaggcaaaaacaaa
cccaaaagcataaagattaaaaaaaagaaacaggggaaaatatctgaactgttgatacgg
aaatccacggagggagatgctggattatacacctgcgaggccgtcaacagccttggaaaa
acaaataccacagcaaacctattcatcatcaacacagccaccagcaccactccctcggcc
aagacatccagtcacgtgacgccctgcaatgagagcgagaaggaatactgtgtaaaccat
ggcaagtgcttcacgctggaggtcacaccaggcaacatcaggcgcctctgcaggtgccct
ccaggattcacagggaaccgctgtcaaaacagagaccctgtgcgagtcgtagaccacaaa
caagctgaggagctctatcagaaacgcgttttgactataacaggcatctgcatcgctctt
ctagttgttggcatcatgtgtgtggtggcttactgcaaaacaaagaaacaacggaaaaag
ctacatgatcgtttgcggcagagtttacgagagcgaaacgctgcagccaaaggccctcaa
caccctcaccctccaccggaaaacctgcagctggtcaatcattacatgccgacgaatcct
gtcccagctcatatgacagacaaagaagcggaaacatcactctccacaaatgagttcaca
tcaccaacacatccgtccacagccatcactcactcatctagccaatgctggagtaatggc
aaagcagagagtgtggtttctgatagtcatgcagtcctgatgaagccatcagctgagaac
tgtcagcacgggacacctagtcacaggggccgtctgaacgctactggaggtgtccatcag
ctcaatgattacctaaagaactccagagaagcccagggctccaacagagactctccttac
agcgagaggtatgtttcagccatgactaccccgacccgtctgtcccctgtggggcttctc
tcgccggtgacgccgtcctctcctccctcagagatgtcagctcctctctccagcctggcg
acctccgtcccatccatgttaaccagtccctctggagaagaggagcgtcctctgctgttc
cggacaccaccaatcctgcgtgacaaatctgcttcaacccaaggccgtaaatcaggccat
aatctccgtaactccgcccactacaatcacggcctggacatccccagccctccacccagc
ccgctgcatatagaggaggagattgattgtttagagcagtacaaaagcacatctgtcccg
tcctccgccccgcacagccccagcgccgcaagaactcaaccgagtggtcaagcggcgcct
gagcaagcggttagtggcagtaactcagagagcagcagctcagagagcgagaccgaggat
gaacgggtgggcgaggacacgccgtttctgggcttacagaaccctctggccgctggttcg
cttgttctggacgggctagagggcagcagaactaaccccgcgctgcacctctcaccgcaa
cacgagctgcagaacagactaacagccgtcatggccaaccaggatcctatagctgtgtga

DBGET integrated database retrieval system