KEGG   Danio rerio (zebrafish): 797549Help
Entry
797549            CDS       T01004                                 

Gene name
galnt9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    797549 (galnt9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    797549 (galnt9)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     797549 (galnt9)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   797549 (galnt9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 797549
NCBI-ProteinID: XP_001338018
ZFIN: ZDB-GENE-060526-21
Ensembl: ENSDARG00000006832
UniProt: F1Q6D3
LinkDB All DBs
Position
5
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSEELVQIGRLSDQRLRGRNAKVTNSMD
RQSILKRLERLEDVVYNQLNGLAKPMGLVEGPGGLGQGGAAATLGEDSRETEGRFEEYGY
NAQLSDRISLDRNIPDYRPKKCKQLTYSDDLPQISVVFIFVNEALSVILRSVHSMVNHTP
AHLLKEIILVDDNSDSVELKFNLDHYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATAP
VVGFFDAHVEFNTAWAEPILTRVKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQDWLDRGDETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEFKSHVYMAWNIP
MNNPGVDFGDVSERVALRKKMNCKSFRWYLEHVYPEMRIYNNTITYGEVRNSKASGYCLD
QGSEEDERAILYPCHGMSSQLARYTTEGLLQLGPLGSTTFLPDTKCLVDDGRGRTPSLKK
CDSVTRSSQRLWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HPRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcacgcaagatcaaaactctgctgacggtcaacattctggtgttcgtcggg
atcatcctgttctcggtctactgcaggatccaggaccggtcggaggagctcgtgcagatc
gggagactgtcggaccaaaggctgcgaggcaggaatgccaaagttacgaactccatggac
aggcagtccattcttaagagactcgagcgactggaagatgtggtctataatcagttaaat
ggtctagccaagcccatgggtctggtggagggtcctggaggtctaggacagggcggtgct
gctgccacgctgggagaggacagccgggagactgaagggagattcgaggagtatggctac
aacgctcagctgagtgaccgcatctccttggacaggaatattccggactacaggcccaaa
aagtgtaagcagctgacctactccgatgaccttccccagatctctgtggtcttcatcttt
gtgaacgaagctctttctgtcatccttcgctcagttcacagcatggtcaaccacactccg
gcacatctgctcaaagaaatcatcctggtggatgacaacagcgacagcgtggagctaaag
ttcaatctggatcattatgtgaataaacgatatcctggcctggtgaagatcgtgaggaac
agtaagagagaaggcctcattcgtgccaggattcacggctggaacgcagccactgctcct
gttgtaggcttctttgacgctcacgtggagttcaacacagcctgggctgagccgatcctc
accagagtgaaagaagatcacactaggataatcctccctgcgatagataatatcaagtac
aatacctttgaggtgcagcaatacgctaatgcggctcatggctacaactggggcctgtgg
tgcatgtacatcatcccgcctcaggattggctggacagaggagatgaaactgctccaatc
aggactccagcaatgatcggctgctcttttgtagtggatcgtgaatattttggagagatc
ggtctgcttgatccgggcatggaggtctatggaggagagaacattgaacttgggatgagg
gtttggcagtgtggtggcagtatggaggttcttccatgtgccagagtcgcacatattgaa
cgcacaaagaaaccatacaacaatgacatcgattactatgctaagaggaatgcgctgcgt
gcggcagaagtctggatggatgagttcaagtcccatgtctacatggcctggaatattcct
atgaacaacccaggagtagattttggagatgtgtcagagcgtgtggcactgaggaagaaa
atgaactgcaagagcttccgctggtacctcgagcatgtatatcctgagatgagaatctac
aataacaccatcacttatggagaggtgcgaaacagtaaagccagcgggtactgtcttgat
cagggctcagaggaggatgagagggccatactctacccttgtcacggcatgtcatcgcag
ctggcaagatacaccactgagggcttattgcagttaggacccctggggtcaactacgttt
ctgcctgacacaaaatgcctggtggatgatggaagaggaaggactccaagcttgaaaaaa
tgtgattctgtcacccggtcttcccagaggctctgggattttactcagaatggccctatc
ataagtcgagacacgggacgctgtttggaggttgaaatgtcaaaagatgcgaactttggc
ctgcggctggtggtccagcgctgctcagggcagaaatggatgattcggaactggataaaa
caccccagacactga

DBGET integrated database retrieval system