KEGG   Danio rerio (zebrafish): 798603Help
Entry
798603            CDS       T01004                                 

Gene name
hdac7a
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    798603 (hdac7a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     798603 (hdac7a)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     798603 (hdac7a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 798603
NCBI-ProteinID: XP_021325750
ZFIN: ZDB-GENE-150129-1
LinkDB All DBs
Position
23
AA seq 960 aa AA seqDB search
MLLSFTQDGSSAAGLIVESDRGRDTHYWGVPGSVWSPEGPVPMDLRVGERLLRPGSGSDT
AFLSPLHPQLLIGYNTQHCSQYSQQQLQRIQQYNMEQHLQDQEQAKQQLQQLKHKDKSQQ
SAVASALVKQKLAQVILKKQKQQAVLERTNSNPLSSPSVAYRSENTLKHTGLWSVLLSML
AFCSCFSASEPNLKVKHKLKKHLNTRKSPLTRKESAPPAVKHRTPDALDSSPSSSSTPVS
GCSSPNDSLPTENGASSSSSSLSHEAQRLLLQDGSLSHFTIQNSSSLPTITLGLPANSKV
EGDLSSLKLGRVPLVSGSSPLLLPLGVEEPLMQPVLILEPSGLVHTPLLAVPGLGPVPLQ
FSASGPHKPLSRTRSEPLPQSPGRLQPHPHLLQQQQHSTHLLHRLKQNTHLGKLMQKSSE
KPRLRQIPSEDMDSEEAGPAAGDAHQGRGRAESQREMENQEEQMNLQHTLILNQSRLWET
QKHLQQLRRQTAQMETLAVPMMLGGGQHRPLSRTQSSPASTSLTLPEKTLPLATPAEPPQ
SQPRFTTGLVYDSQMLKHQCTCGDNSSHPEHAGRIQSIWSRLQERGLRGQCESIRGRKAT
LEELQSVHTERHVLLYGTNPLNRLKLDNRKLAGILSQRMFVMLPCGGVGVDNDTIWNEMH
TSTASRMAAGSVTELAFRVAKGELKNGFAVVRPPGHHADPSNPMGFCFFNSVAIAAKQLQ
QKLSASKILIVDWDVHHGNGTQEIFYNDPSVLYISLHRYDNGNFFPGSGGPAEVGSGAGE
GFNVNVAWTGGLEPPMADAEYLAAFRTVVMPIAQEFSPDVVLVSSGFDAAEGHPSPLGGY
KVTAKCFGFMTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLGLEEPLPESTLLQ
TPSASGVLSLQRVLQIHSQYWSSLKPLMGTVGMSFLGAQRKDCEETDTVNAMASLSVGVL
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgcttttatccttcacacaagatggaagtagcgcagcgggcctgatcgtcgagtcagac
cgaggaagggacactcactactggggagtgccaggctcagtgtggtcccccgagggcccc
gtccccatggacctgcgtgtgggagagcgtctgctgcggccgggctcgggttcagacacg
gccttcctgtccccgctgcaccctcagctgctgatcggatacaacacacagcactgttcc
cagtacagccagcagcagctgcagcgcatacagcagtataacatggagcagcatctccaa
gaccaggagcaggccaaacagcagctccagcagctcaaacacaaggacaagagtcagcag
agtgcagtggccagtgcgctggtgaagcagaagctggctcaggtgatcctgaagaagcag
aagcagcaggccgtgctggagagaaccaactccaacccgctgagcagcccgtctgtcgcc
taccggtcagagaacacactgaagcacacaggtctctggagtgttttgttgagcatgctg
gctttttgttcgtgtttttcagcctctgagcccaacctgaaggtgaagcataaattaaag
aagcacctgaacacccgcaagagtcctctgacccgcaaggagagcgcaccgcccgccgtt
aaacaccgcactcctgatgcactcgattcgtcccccagcagcagcagtactcccgtgtcc
ggctgcagctccccgaatgacagtctgcccactgagaacggggcgtccagcagcagcagc
agcctgtcccacgaggctcagaggctgctgctgcaggacggctctctgtctcacttcacc
atccagaactcctccagtctgcccaccatcacactcggcctgcctgcgaacagcaaggtg
gagggtgatctgagctccctgaagctgggtcgtgtgccgctggtgtctgggtcgtctccg
cttcttctccctctgggtgtggaggagccactcatgcagcccgtcctcatcctggagcca
tcaggactcgtacacacaccactgctggccgttccaggtctgggtccggttcctctgcag
ttcagtgcgtccggtcctcataaaccgctgagccgcacacgctcagagccgctgccgcag
agtcccggccgcctgcagccgcacccacacctgctccagcagcagcagcacagcacacac
ctgctgcacagactcaagcagaacacacacctgggcaagctgatgcagaagtcgagcgag
aagccgcgtctccgtcagatcccctcagaggacatggactcagaggaggcggggcctgca
gcgggtgacgcccaccaggggcggggcagggcggagtctcagagagaaatggagaatcag
gaggagcagatgaacctgcaacacacactcattctcaaccagtcgcgtctgtgggaaaca
cagaagcacctccagcagctgcgcagacagacggctcagatggagacgctggcggttccc
atgatgcttggcggcggacagcaccggccgctctcccgaacacagtcatctccagcctcc
acatcactgacactgcctgaaaaaaccctgcccctcgccacgccagcagagcccccgcag
agccagccgcgcttcactaccggtctggtgtatgactcccaaatgctgaagcaccagtgc
acatgcggagacaacagcagtcacccagagcatgctgggagaatccagagcatctggtcc
cgcctgcaggagaggggcctcaggggccagtgtgagagtattcgagggagaaaagccacc
ctagaggagctgcagtctgtgcacacggagagacacgtcctgctgtacggcaccaacccg
ctcaacagactcaaactggacaaccgcaaactagccggcattctgtcacagcggatgttc
gtcatgctgccctgcgggggagtcggggtggacaatgacaccatctggaatgagatgcac
acgtccacagcttcccgcatggcggccggcagcgtgacggagctggccttcagagtggct
aaaggagaactcaagaatggctttgctgtggtcaggccaccgggacatcacgcagacccc
tcaaaccccatgggtttctgtttcttcaactcggtggcgatcgctgctaaacagctccag
cagaagctcagcgccagtaaaatcctcatcgttgactgggatgttcatcatggcaatggc
actcaggagatcttctacaatgaccccagcgtcctctacatctctctgcatcgctacgat
aacggaaacttcttccccggcagtggaggaccagcagaggtgggttctggtgccggcgag
ggcttcaatgttaatgtggcgtggaccggtggactggagcctcccatggcggatgcggag
tacctggctgccttcaggacggtggtgatgcccatcgctcaggagttttccccagatgtg
gttttggtctcttcaggcttcgacgctgcagaaggacacccgtctcctttaggaggatac
aaagtcactgccaaatgtttcggcttcatgactcgtcagctgatgacgctagcaggagga
cgtgtggttctagcgttagagggaggtcacgaccttacagccatatgtgacgcgtctgaa
gcctgtgtcagtgctctgctggggctggaggagcctcttcccgagtcgactcttctgcag
acgcccagcgctagcggagtgctgtccctgcagagagtgctgcagatacacagtcagtat
tggtcctccctgaagccgctgatgggcacggtgggcatgtcctttctgggcgctcagagg
aaagactgtgaggaaacagacacggtcaatgccatggcgtctctttcagtcggagtcctg

DBGET integrated database retrieval system