KEGG   Danio rerio (zebrafish): 799566
Entry
799566            CDS       T01004                                 

Gene name
eif4ebp1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03013  RNA transport
dre04012  ErbB signaling pathway
dre04150  mTOR signaling pathway
dre04218  Cellular senescence
dre04910  Insulin signaling pathway
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    799566 (eif4ebp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    799566 (eif4ebp1)
   04150 mTOR signaling pathway
    799566 (eif4ebp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    799566 (eif4ebp1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    799566 (eif4ebp1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    799566 (eif4ebp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dre03019]
    799566 (eif4ebp1)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     799566 (eif4ebp1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 799566
NCBI-ProteinID: NP_955939
ZFIN: ZDB-GENE-030131-2332
Ensembl: ENSDARG00000043608
Vega: OTTDARG00000022705
UniProt: Q6PFS8
LinkDB
Position
21
AA seq 120 aa
MSMGSQKTTSQAIPTTRRVILNDAAHLPHDYSTTPGGTLFSTTPGGTRIIYDRKFLLDCR
SSPLARTPPCCLPDIPGVTSPPSVTVNNEKAYPKPTVNNNSISPPVDKSTGEDAQFEMDI
NT seq 363 nt   +upstreamnt  +downstreamnt
atgtccatgggcagtcagaagaccaccagtcaggcaattccaaccaccagacgagtcata
ctcaacgatgcggcccatctgcctcatgattactcgacaacacccggggggacccttttt
agcacgactcctggaggcacccggatcatctatgaccgaaagttcctgctggactgtcgc
agctctccattggcccgcacaccgccctgctgcctgcctgacattcctggggtgaccagt
cctccttcagtcaccgtaaataatgaaaaggcctaccctaaacccactgtcaataataac
agcatcagccccccggtggacaagagcacaggggaggatgcccagtttgaaatggacatc
taa

DBGET integrated database retrieval system