KEGG   Danio rerio (zebrafish): 799569Help
Entry
799569            CDS       T01004                                 

Gene name
si:dkey-28d5.14
Definition
(RefSeq) C-type mannose receptor 2-like
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C UL45 CSN5_C
Motif
Other DBs
NCBI-GeneID: 799569
NCBI-ProteinID: XP_021333342
ZFIN: ZDB-GENE-060503-730
Ensembl: ENSDARG00000077136
LinkDB All DBs
Position
7
AA seq 367 aa AA seqDB search
MAQTQYFPLLLIALCSISECVQRQYHFINEEKEWAEAQRYCREKYTDLATVDNMNDMIQL
NKSVNVNVNDGVWIGLQGTNDSNWHWSSGDPVFFVNWASGQPAGSNNCTVMTNGKWFVGS
CSNTWTFICKMSGGLVFVNQTMNWRDAQSYCRQNHIDLVSVRNQNESQQLEKFINDSHKF
GSEVWIGLFSDPWQWSDKSNSSFRYWNAEKAKAPDDKHCGVVEMSNQGQWSDYLCSVRWQ
LPFVCHEDKLIVVQQNLSWSEALRYCRQNHVDLVSVKSVEMQYKVMNVVKLASTEAVWLG
LRHSCALGIWFWVSGETVCYQYWAPGNGTSEEDCEPTVRSGAVQSGGNQTWISRPETDQL
NFICTNY
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggctcagactcaatatttccctcttctcctcattgctctctgctccatatctgaatgt
gttcagcgtcagtatcactttatcaatgaggagaaggaatgggctgaagctcagagatac
tgcagagagaaatacacagatctggccactgttgacaacatgaatgacatgatccagctg
aacaagagtgtgaatgtgaatgtgaatgatggtgtctggattggtcttcagggtacaaat
gacagtaattggcattggtcttcaggtgatcctgtgttctttgtgaactgggcatctgga
caaccagccggcagtaataattgtactgttatgactaatggaaagtggtttgttggatca
tgtagtaacacctggactttcatctgcaaaatgagcggaggactggtgtttgtcaatcag
acgatgaactggagagatgctcagagttactgcagacagaatcacattgatctggtcagt
gtgaggaaccagaatgagagtcaacagctggagaagttcattaatgacagtcataaattt
ggatctgaagtctggatcggtctgttcagtgacccatggcagtggtcagataagagcaac
tcctcattcagatactggaatgctgaaaaagctaaagctccagatgataaacactgtgga
gtggttgaaatgtccaaccagggacaatggagcgactacttgtgtagtgttagatggcag
cttccttttgtgtgtcatgaagataaactgattgtggtccagcagaatctgtcgtggtct
gaagctctgagatactgcagacagaatcatgtggatctggtctcggttaagtcagtggag
atgcaatataaggtgatgaacgtggttaaactggcgtctactgaggcggtgtggttgggt
ttacgtcactcctgtgctttgggcatctggttctgggtgagtggagagaccgtgtgctat
cagtactgggctccagggaacggcacatcagaggaggactgtgagcccacagtgagatct
ggagcagttcagtctggaggaaatcagacctggatcagccgtcctgaaactgaccaactc
aacttcatctgcacaaactactga

DBGET integrated database retrieval system