KEGG   Desulfotomaculum reducens: Dred_0757
Entry
Dred_0757         CDS       T00494                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:drm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dred_0757
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:drm01007]
    Dred_0757
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:drm03016]
    Dred_0757
   03029 Mitochondrial biogenesis [BR:drm03029]
    Dred_0757
Enzymes [BR:drm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Dred_0757
Amino acid related enzymes [BR:drm01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Dred_0757
Transfer RNA biogenesis [BR:drm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Dred_0757
 Prokaryotic type
   Other AARSs
    Dred_0757
Mitochondrial biogenesis [BR:drm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dred_0757
SSDB
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d
Other DBs
NCBI-ProteinID: ABO49295
UniProt: A4J2J2
LinkDB
Position
809588..811390
AA seq 600 aa
MSAESMNGLHRTLYCGELHKQHEGQEVTLMGWVQRRRDHGGLIFVDLRDRSGIVQVVFSP
EVDQEAFKKAEGVRNEYVLAVVGRVNGRPEGTINPNMATGEVEVYAHTLRLLNRAKTPPF
YIEDNIEVDENLRLRYRYLDLRRPEMHKAMMLRHRASKSIRDFLDQHGFLEIETPMLTKS
TPEGARDYLVPSRVNPGKFYALPQSPQLFKQILMLAGMERYFQIVRCFRDEDLRADRQPE
FTQIDLEMSFVEAEDVMGLMEQMIAEVCSDTIGVKISTPIPRLSYQEAMDRFGSDKPDTR
FGLELKDITPIAAQCGFKVFNSTVAGGGQIKGINAKGCASFSRKEIDDLTAFVAVYKAKG
LAYFIINEDGSVKSAIAKFFTEEEIAAIKDKMEAQPGDLLLFVADKPAVVAASLGALRVH
LAERLELIPQGMWNFLWVTDFPLLEYDSEAGRFFAMHHPFTSPAEEDLPLLESNPGKVRA
RAYDMVLNGVEIGGGSIRIHRRDIQELMFKALGMSQEEAKEKFGFMLEAFEYGAPPHGGL
AFGLDRLVMLLAGKDSIRDVIAFPKTASATCLMTQAPDVVDPAQLAELHIRSTAPVKKSN
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgtctgctgaatctatgaatggacttcatcgtactttatactgtggtgaattgcataag
caacatgaaggccaggaagttacactgatggggtgggtgcaaagacgtcgagaccatggg
ggcctaatctttgtagatctgagggatcgttccggcattgttcaggttgtttttagcccg
gaagtagatcaagaagcctttaaaaaggctgaaggggttcgaaatgagtatgtcctggca
gtggtcggaagggtaaacggtcgtccggagggaaccattaatcctaatatggccactgga
gaagtggaagtttacgcacataccttacggttactaaaccgtgccaaaacgccccctttc
tatattgaagataacatcgaagtggatgagaacctgcgtctgcgttatcgttatcttgat
ttgcgccggccagaaatgcataaggctatgatgctacgccatcgggcctctaagagtatc
agggatttcctggatcaacatggctttttggaaattgaaacacccatgttaaccaagagt
acccccgaaggggccagggactatttagtgcccagtagggtaaaccccggtaaattttat
gccttaccccaatctccccagctttttaaacaaattttaatgttagctggtatggagcgt
tatttccaaattgtacgctgtttccgggacgaagacctgcgggcggaccgtcaaccggaa
tttacccaaatcgacttggaaatgtcctttgtggaagcagaagatgttatgggcctcatg
gaacaaatgattgccgaagtatgcagtgataccatcggtgtcaaaataagcacacctatc
ccgcgtctttcctatcaggaggctatggatcgtttcggttcggacaaacctgacactcgc
tttgggctagagttaaaggatataacacccattgctgcccagtgtggttttaaagtattt
aacagtacagtagctggtggagggcagattaagggaatcaatgcaaagggctgtgccagt
ttctcacggaaagaaattgacgatttaacagccttcgtagctgtttataaagctaagggt
ttagcttactttattattaatgaagatgggtcggtaaaatcggccattgctaagttcttt
actgaagaagagattgctgccatcaaggataaaatggaagcacaacctggagatttactg
ttattcgtggcagataaacctgcggttgtagctgcctctttgggggcgttacgggtccac
ctggcggaacgcttggagctgattccccagggaatgtggaatttcctttgggtaactgat
ttcccattactggagtacgattccgaagcaggacgtttctttgctatgcaccacccattt
acatcaccggcggaggaagatctgccactgctggagagcaatcctggtaaggttcgtgcc
cgtgcctatgatatggtattgaacggtgtagaaattggtggaggtagtattcgtatccac
cgtagggatatacaggagctaatgtttaaagccctgggtatgagtcaagaggaagcaaag
gagaaatttggctttatgttagaggcctttgaatacggtgctcctccccatggtgggctg
gcctttggtttagaccgtctagtcatgttattggccggtaaagacagtatccgtgatgta
attgcctttcccaaaactgccagcgcaacctgtttgatgacccaagcaccggatgtggtg
gatcctgcccaactggcagaacttcatattcgtagcacggctccggttaaaaagagtaat
taa

DBGET integrated database retrieval system