KEGG   Desulfotomaculum reducens: Dred_1647
Entry
Dred_1647         CDS       T00494                                 

Definition
(GenBank) tyrosyl-tRNA synthetase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:drm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dred_1647
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:drm01007]
    Dred_1647
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:drm03016]
    Dred_1647
   03029 Mitochondrial biogenesis [BR:drm03029]
    Dred_1647
Enzymes [BR:drm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     Dred_1647
Amino acid related enzymes [BR:drm01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Dred_1647
Transfer RNA biogenesis [BR:drm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Dred_1647
 Prokaryotic type
    Dred_1647
Mitochondrial biogenesis [BR:drm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dred_1647
SSDB
Motif
Pfam: tRNA-synt_1b S4 S4_2 TyrRSs_C
Other DBs
NCBI-ProteinID: ABO50175
UniProt: A4J522
LinkDB
Position
1801389..1802612
AA seq 407 aa
MLDFQKQLEIIRRGVAEIVPEEELVEKLKKSVASNKPLHIKLGLDPSAPDIHLGHTVVLQ
KLRQFQELGHNITIILGDFTGRIGDPTGKSVARKPLTEEEVLANARTYEQQIFKILDPEK
TKVHFNSTWLAPLKFEDVIKLAATTTVARMLEREDFTKRMRENLPISIHEFFYPLMQGYD
SVALEADIEMGGTDQKFNLLMGRTLQKEFGQEPQVAIMMPILEGLDGVNKMSKSLGNYIG
IDEPPQEMYGKTMSLPDELMVRYFELVTPVPLEEVKAIAKGLEDGSLHPRDVKMRLGREI
VTFYHGPEAALQAEDHFKTVFQKGEIPDEIDEFLVSGDLLEEGLVALPKLLTQAKLAGTN
SEARRLIKEGAVKINGEKATDPNMRLKPQEGMIIRTGKRKFAKLILK
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgttagattttcaaaaacaacttgagattattagacggggcgtggcagagattgttcct
gaagaggaactggtagagaagttaaaaaagtctgttgccagtaataaacctttacatatt
aagctgggactagacccctcggccccagatattcacctgggtcatactgttgtgttgcaa
aaattgcgtcagtttcaggaactgggccacaacattactattattctgggtgattttaca
ggtcgaattggcgatcccactggcaaatccgtagcaagaaaaccattaacggaagaagaa
gtactggccaatgccaggacctatgaacaacaaatctttaaaattttagatccagaaaaa
accaaagtacactttaatagtacatggcttgctcccttaaaatttgaagatgttataaaa
ttagctgcaactactacggtcgccagaatgttggaacgcgaggactttacaaaacgcatg
agggaaaatttacccatcagcattcatgagtttttctatcctttaatgcaaggctatgat
tctgttgccctggaagcagatatagaaatgggagggacggatcaaaaattcaacttgtta
atgggacgaactttgcaaaaggaatttggccaagaaccacaggttgcaatcatgatgcca
attcttgagggccttgatggtgtaaataaaatgagtaagagtctaggtaactatatcggt
attgatgaaccaccacaagaaatgtacggaaaaacaatgtctcttccagatgagttaatg
gtgcgctattttgagttggttacaccagtgcctttagaagaagttaaagcaattgccaag
gggttggaggatggttcgctgcatcccagggatgtgaagatgagattgggcagagaaatt
gtgacattctaccatggacccgaggcggccctgcaagcagaagatcattttaaaacggtc
tttcaaaagggggaaatccctgatgaaatagatgagtttttagtctcgggggatttactt
gaagaaggtttagtagcgttacccaagcttctaacccaggctaagctagctggtaccaat
agcgaagcaaggaggcttataaaagaaggggcagtaaaaattaacggagagaaagcaact
gatcccaatatgagattgaaaccacaagaaggtatgattattcggacgggtaaacgtaaa
tttgctaaactgatattgaaataa

DBGET integrated database retrieval system