KEGG   Desulfotomaculum reducens: Dred_1714Help
Entry
Dred_1714         CDS       T00494                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
drm  Desulfotomaculum reducens
Brite
KEGG Orthology (KO) [BR:drm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:drm01001]
    Dred_1714
Enzymes [BR:drm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dred_1714
Protein kinases [BR:drm01001]
 Serine/threonine kinases: Other
  Bacterial family
   Dred_1714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kdo RIO1 Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: ABO50241
UniProt: A4J588
LinkDB All DBs
Position
1872834..1874699
Genome map
AA seq 621 aa AA seqDB search
MIGKLLGNRYEILEQLGGGGMALVWKGKDTFLNRLVTIKVLRPEYASDQEFVRRFRREAQ
AVASLSHPNIVSIYDVGQENESHYLVMEYVDGESLKEMIRREAPLAPFRVIQLGRQIADA
LEHAHENSIIHRDVKPHNILITRSGRAKLTDFGIAQASASTITHTDTIVGSVHYISPEQA
KGEPAGPKSDIYALGVVLYEMLTGQVPYQADGAIGVALKHIQEEPLSLREINPNVPEDLE
KVVLRAMDKRQDRRHKSAKALGEDLVSISDETRNMVPYNHEEEYTRVLPSPVIIKNEAKA
KFAEEKPVKKKQMKPAAWAMLGLLVLLLLAGSYFALSSYLNVGEVKIPKVTGMKVDKAEK
VLKDLGLSVNISKVYHDTIEKDYVISQDPEANEVVKKVRPVTLVVSRGQDLVEVPDVIRL
PYDEARLTLLNLQFQVDTPDSVYSNSIEKDRVAEQKPEGKTKAPRGSHVKLSLSQGPEPK
MQKVPNLSGLTQEAARAQLASLGLEMDENIDQRESDEYLSGQIVGQEPAPGSDLAEGNKV
KVTISTGPGPVAKQMTVTIHVPDDGKTHEVRIETEDVRGRYNQYISTHQPGDDVTRNIRF
YGKGKVRVYIDNVLQEEEPIE
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgataggcaaacttctgggtaaccgttatgaaatattagaacaattaggcggcggaggc
atggctctggtatggaaagggaaggatacctttttaaaccggctggttaccattaaagtg
ttgaggccagaatatgccagtgatcaagagtttgttcgccgcttccgtcgggaagcccag
gctgtggccagcctgtcccaccccaatattgtaagcatatacgatgtcggacaagaaaat
gaaagtcattacttggtcatggagtatgttgatggggaaagtcttaaggaaatgattcgc
agagaagcgcccctggccccatttagagttattcaactggggcggcaaattgccgatgcc
ctagaacatgcccatgaaaatagtattattcaccgagatgttaagccccataatatatta
attaccagaagcggacgggccaagttaacggattttggcattgcccaggccagtgcttct
accattactcatacggataccattgttggttcagttcattatatatcgccggaacaggcc
aaaggggaaccggctgggccaaaatcggacatctatgccctaggtgttgttctttatgaa
atgttaaccggacaggttccttaccaagccgatggagcaattggagtggccctaaagcat
attcaagaagagcccctttcgttaagagaaataaacccaaacgttccagaggacttagaa
aaggtcgtattacgggccatggataaacgacaggatagaagacataaaagtgcaaaggcc
ttaggtgaagacctggtttccatcagtgatgaaacgaggaatatggtcccctataatcat
gaggaagaatatactcgtgttttaccaagtcctgtcattataaaaaacgaagcaaaggca
aaattcgcagaagaaaaacctgtcaagaagaagcagatgaaaccagcggcttgggccatg
ctgggcttactggttttgttacttttggccgggtcttactttgctcttagcagttattta
aatgttggggaagtcaaaattcctaaggtaacaggaatgaaagtggataaagctgagaaa
gtcttgaaggatcttggactcagcgtaaatatttccaaagtgtaccatgataccattgaa
aaggattatgtcatatcccaggacccagaggctaatgaagttgttaaaaaggtgcgaccc
gttaccctggtggttagccgtggccaggacttagttgaggtaccggatgtcattaggctt
ccttatgatgaggcgcgactaaccttactaaatttacagtttcaagttgatacacccgat
agtgtatacagcaatagtattgaaaaggacagggtggcagagcaaaaaccagagggaaaa
accaaggcacctcggggcagccacgtaaagttaagtctcagtcaggggccagagccgaaa
atgcaaaaggttcctaatctttctggtcttacacaggaagctgctagggctcagctagcc
agtcttggacttgaaatggacgaaaacattgaccaaagggaaagtgatgaatatctaagt
ggtcagattgttggccaagaaccggcccctgggagtgatctggccgaggggaataaggta
aaggtaaccattagtactggaccgggacctgtagcaaagcaaatgacagttacgatacat
gttccggatgacgggaaaacccacgaggttagaatagagactgaagatgtgagaggaaga
tacaatcaatatatcagtacgcatcaaccgggagacgatgtgactagaaatatacggttc
tatggaaaaggaaaagtaagggtttatatagataatgttttacaggaagaggaacctatc
gaataa

DBGET integrated database retrieval system