KEGG   Desulfotomaculum reducens: Dred_1796Help
Entry
Dred_1796         CDS       T00494                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00473  D-Alanine metabolism
drm00550  Peptidoglycan biosynthesis
drm01100  Metabolic pathways
drm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:drm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Dred_1796
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dred_1796
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Dred_1796
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:drm01011]
    Dred_1796
Enzymes [BR:drm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Dred_1796
Peptidoglycan biosynthesis and degradation proteins [BR:drm01011]
 Precursor biosynthesis
  Amino acid ligase
   Dred_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 GARS_A ATP-grasp RimK ATPgrasp_ST ATP-grasp_2 ATP-grasp_4 YycH
Motif
Other DBs
NCBI-ProteinID: ABO50321
UniProt: A4J5G8
LinkDB All DBs
Position
1968987..1969925
Genome map
AA seq 312 aa AA seqDB search
MALRIGVLCGGRSAEREVSLRSGEAVYQALMAAGYNDVVKIDVGYDLVEQLKGNEIQVAF
LALHGKYGEDGTIQGLLEMLDIPYTGSGVLASALAINKIATKKIFKMEGIPTPAFSVITK
KEVEDKSLQEAALRAIKEVGVPAVVKANTQGSTIGITFVHVKEKMAEAIESALKYDQDVL
VEQFVAGTEVTASVLGNNSPEALPLIEITSVTGVYDYQSKYTPGMSDHIIPPRLPQDIQE
KIKELAIKSFLSLGCRGLGRIDFIIRDNQPYALEVNTLPGMTATSLFPDAANYAGISFPE
LTDRLIKLALEQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttggcattgcgtataggagttttatgcggtggacgttccgcagaaagagaggtttcctta
aggagtggtgaagcagtttatcaagctttaatggcagcaggctacaatgatgtagtaaaa
atagatgtaggttatgatttagtagagcagttaaagggaaatgagattcaagttgcattt
ttagctctccatggaaaatatggtgaagatggcaccattcaaggcctgctggaaatgctg
gacattccatatactgggagtggggtacttgccagtgctttagctatcaacaaaatagct
acaaaaaaaatatttaagatggaaggaataccaacgcctgccttttcggtgataacaaaa
aaagaagtggaggataaaagcttacaagaagctgcccttcgagcaataaaagaggtgggt
gtgccagcagtggttaaagcgaatacccaaggctccaccatcggtattacatttgttcat
gtgaaagaaaaaatggctgaggccattgaatctgccttaaagtatgaccaagatgtactg
gtggaacagtttgttgcagggactgaagttacagcctcggttctaggcaataatagccct
gaagctttacctttgatcgaaatcacctctgtaactggagtctatgattatcaatccaaa
tacacacctggcatgagtgatcatatcataccaccacggttaccccaagatattcaggaa
aaaataaaggaactggccattaaaagttttttatcccttgggtgtaggggacttggccgc
atagactttattataagagataatcaaccctacgctcttgaggttaataccttaccgggc
atgaccgcaaccagtttgttccctgatgctgcaaattatgcaggaataagtttcccagaa
ttaacagatcgtctgattaaactggctttggaacaataa

DBGET integrated database retrieval system