KEGG   Desulfotomaculum reducens: Dred_1868Help
Entry
Dred_1868         CDS       T00494                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00020  Citrate cycle (TCA cycle)
drm00190  Oxidative phosphorylation
drm00650  Butanoate metabolism
drm00720  Carbon fixation pathways in prokaryotes
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01120  Microbial metabolism in diverse environments
drm01130  Biosynthesis of antibiotics
drm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:drm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dred_1868
   00650 Butanoate metabolism
    Dred_1868
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dred_1868
   00720 Carbon fixation pathways in prokaryotes
    Dred_1868
Enzymes [BR:drm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dred_1868
    1.3.5.4  fumarate reductase (quinol)
     Dred_1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_9 Fer4_17 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ABO50392
UniProt: A4J5N9
LinkDB All DBs
Position
complement(2053905..2054651)
Genome map
AA seq 248 aa AA seqDB search
MSKMVSLKIKRQSDVSTAAYWEEFMIPYKEKMNVISLLKEIQKNPVNAKGEATTPVVWEC
NCLEEVCGACTMLINGKARQACSALVDQLQQPIVLEPLSKFPLVRDLMVDRSIMFDHLKK
VKAWIPIDGTYDLGPGLRMAQRVQEDSYPISRCMTCGCCLEACPNVNSKSKFIGPAPLAQ
VKLFNSHPTGAMNQEERLDAIMGVGGITDCGNAQNCVKVCPKQIPLAKTIAQLNRDTTIH
GIKRWLGR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatggtgtccttaaagattaaacgtcagtctgatgtatccacagcggcttat
tgggaagaatttatgattccatataaagaaaaaatgaatgttatatctcttttaaaggag
attcaaaagaacccagtgaatgccaagggagaagcaacaacacccgtggtttgggagtgc
aactgtttagaagaagtatgcggcgcttgtaccatgcttattaatggaaaagcacggcag
gcatgttcggctctggttgaccagcttcagcaacccattgtattagaacccttaagtaaa
ttcccccttgtgcgtgatttaatggttgatcgttctattatgtttgatcatttaaagaag
gttaaggcatggattcccattgatggaacatacgaccttggtccgggactccgtatggct
caaagggttcaggaagactcctaccccatttcccgctgcatgacctgtggctgttgtttg
gaagcttgccccaatgttaatagcaaatcaaaatttattggaccagctccgttggcccaa
gttaaactgtttaactctcaccccactggtgccatgaaccaagaagaaagactggatgcc
atcatgggagtgggtggtatcacagactgtgggaatgcacagaattgtgtaaaggtatgt
cctaaacaaatcccgctggctaaaaccattgcgcaactaaatagagatacaacaatacat
ggtataaaaagatggttaggcaggtaa

DBGET integrated database retrieval system