KEGG   Desulfotomaculum reducens: Dred_1869Help
Entry
Dred_1869         CDS       T00494                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00020  Citrate cycle (TCA cycle)
drm00190  Oxidative phosphorylation
drm00650  Butanoate metabolism
drm00720  Carbon fixation pathways in prokaryotes
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01120  Microbial metabolism in diverse environments
drm01130  Biosynthesis of antibiotics
drm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:drm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dred_1869
   00650 Butanoate metabolism
    Dred_1869
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dred_1869
   00720 Carbon fixation pathways in prokaryotes
    Dred_1869
Enzymes [BR:drm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dred_1869
    1.3.5.4  fumarate reductase (quinol)
     Dred_1869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 FAD_oxidored HI0933_like AlaDh_PNT_C FAD_binding_3 NAD_binding_8 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ABO50393
UniProt: A4J5P0
LinkDB All DBs
Position
complement(2054648..2056405)
Genome map
AA seq 585 aa AA seqDB search
MQNKIIVVGGGLAGLMATIKAAEMGVKVRLFSLVPVKRSHSVCAQGGINGAVNTKGEGDS
PWIHFDDTIYGGDFLANQLQVKNMCEAAPAIINLMDRMGVMFNRTPEGLLDFRRFGGSKH
HRTAFAGATTGQQLLYALDEQVRHWEVAGFVEKYEGWDLLSIVMDSENICRGIVAQDLKS
MKVQSFSGDAVILATGGCGIVYGKSTNSTINTGAAASAVYQQGVYYANGEMIQIHPTAIP
GDDKLRLMSESARGEGGRLWTIKDGKPWYFLEEWYPAYGNLVPRDIATRAIYRVCYELKL
GIEGKNMVYLDVSHVEREILDKKLAGILEIYERFVGDDPRKVPMRIFPAVHYSMGGLWVD
YDQMTNITGLFACGECEYQYHGANRLGANSLLSAIYGGMVAGPNAVKYLHSLKRTAQDVS
QSIFTQEEKRQQAWVEKTYKMDGTENVYKLHEELGEWMTENVTVVRYNKKLQETDQKIQE
LIARWHRIKLTDKSIWANQEVTFVRHLWHMLQLSRVITLGALARNESRGAHYKPEFPDRD
DQNWLKTTKAKYTFNGPELTYEDIDTSLIKPRPRRYDVDKGALNK
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataaaatcattgtggttggcggtggtctggctggtttaatggcaaccataaaa
gctgcggagatgggtgtgaaggttcggctgttttctttggttccggttaaaagatcccac
tcggtgtgtgcccagggtggaatcaacggagctgtaaacaccaaaggcgaaggcgattct
ccctggatacattttgatgacacaatttacggcggggactttctggccaaccaactccaa
gtaaaaaatatgtgtgaggcagccccggcaattattaatttaatggatcggatgggtgtt
atgtttaatcgaactcccgaaggtttattagattttagaaggtttggtggcagtaaacat
cacaggacagcctttgctggggctactactggacaacaattattatatgcccttgatgaa
caggttcgacattgggaagtggctggctttgtagaaaaatatgaaggctgggatctttta
tccatcgttatggatagtgaaaacatttgccgaggcatagtagcccaagatctaaaaagc
atgaaagtccagtctttttcaggtgatgctgtgattctggccactggtggttgtggcatt
gtgtatggtaagagtaccaattccaccattaatacaggggctgctgccagtgcagtttat
cagcagggggtctactatgccaatggcgaaatgatccaaattcaccccaccgctatccct
ggggatgacaaactgagattaatgagtgaatcggcccggggcgaaggggggcgtctgtgg
accattaaggatggcaagccgtggtacttcctggaggaatggtaccctgcctatggcaac
ttggttccgcgggatattgcaacccgggcaatttatagggtatgctatgagttgaaactt
ggtattgaaggaaaaaacatggtttatctggatgtttcacacgttgagcgagaaatattg
gataaaaaactagcaggtattctggagatttatgaacgttttgtgggggatgacccacga
aaagttcctatgagaatctttccagcggttcattactccatgggcggtctttgggtggac
tatgatcaaatgacaaatattaccggtttgtttgcctgtggtgagtgtgaatatcagtac
catggtgcaaaccgccttggcgctaattcattattatcagcaatttatggcggaatggtt
gccggacccaatgcagtaaagtaccttcattctctgaaaaggacagcacaggatgttagc
caaagtatatttacacaagaagaaaagcgtcaacaagcttgggtagagaaaacttataaa
atggatggtacagagaatgtttataaactgcatgaagagttaggggaatggatgacagaa
aacgttacagtggtacgatacaataaaaagcttcaagaaacagatcaaaaaatacaggaa
ctcattgcaagatggcatcgaataaaattaacggataagagcatctgggcgaatcaagaa
gtgacttttgttcggcatttgtggcatatgctgcagttgtccagggttattacgctgggg
gcgctggctcgcaatgaaagcaggggagcccattataaaccggaatttccagatcgtgat
gaccaaaactggttaaaaacaaccaaggcaaaatatactttcaatggtccagaattaacc
tatgaagatatagatacttcgcttattaagccaaggccgcggagatatgatgttgataaa
ggggcgttgaataaatga

DBGET integrated database retrieval system