KEGG   Desulfotomaculum reducens: Dred_1986Help
Entry
Dred_1986         CDS       T00494                                 

Definition
(GenBank) DNA primase, small subunit
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
drm  Desulfotomaculum reducens
Pathway
drm03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:drm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Dred_1986
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:drm03400]
    Dred_1986
Enzymes [BR:drm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dred_1986
DNA repair and recombination proteins [BR:drm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Dred_1986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABO50504
UniProt: A4J601
LinkDB All DBs
Position
complement(2181598..2182509)
Genome map
AA seq 303 aa AA seqDB search
MSTISTTETRIEGKNIKLTNLNKLMWPEGLTKAHLVKYYTDVAPYLLPYIKERPLVMKRY
PDGIEGGFFYQKECPNYAPEWIKTESIRHSDKTVNYIICEDAATLVWLANQGCIEIHAWL
CKQSHIEYPDIAIIDLDPGEEAKFRDVLEVALVIKNALDHLKLVGYPKTSGATGIHIFIP
LRPVYTFQQVTKAMGLIAQTVADAFSEKATIERSLAKRDKRKIYVDYLQNTRGKSMAWTY
SLRPIAGAPISTPVMWEEIEKLHLKPSEFNIYTMGNRLKFFGDLHQDLLRKHQDIGHILR
LIS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactatatcaacaacagagacaagaatagaggggaaaaatataaaacttactaat
ttaaataagttaatgtggcccgagggcttgaccaaagcacacctagtaaagtattatacg
gacgttgcgccttatttacttccttatataaaagagcgccccttggtaatgaaacgttat
ccagatggtattgaagggggatttttctatcagaaagaatgtcccaattatgctccggaa
tggataaagacagagtccatacgacattcagataagacagtgaattatataatttgtgaa
gatgctgctaccttggtgtggttagccaatcagggatgtatagaaatacatgcatggtta
tgcaaacaaagtcatatagaatatccagatattgctattattgatttagacccgggagaa
gaggcaaagtttcgagatgtattagaagtggcattggtgatcaaaaatgcgttagaccac
ttaaagctggttggttacccgaaaacctctggggcgactggtattcatatttttattcct
cttaggccggtatatacctttcaacaggtaaccaaggcaatgggtttaattgcacaaaca
gtagcagatgctttctctgagaaagcaaccattgagaggtccttagctaaaagggataaa
agaaaaatctacgttgattacctacagaataccagaggtaaaagcatggcatggacctat
agtttgcgacctattgctggtgcacccatatcaacaccagtgatgtgggaggaaattgaa
aaactgcatttaaagccaagtgaatttaatatttatacaatgggaaataggcttaaattt
tttggggacttacaccaagatcttttgcgaaagcatcaggacataggccatattttaagg
ttgatctcataa

DBGET integrated database retrieval system