KEGG   Desulfotomaculum reducens: Dred_2078
Entry
Dred_2078         CDS       T00494                                 

Definition
(GenBank) LSU ribosomal protein L32P
  KO
K02911  large subunit ribosomal protein L32
Organism
drm  Desulfotomaculum reducens
Pathway
drm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:drm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dred_2078
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:drm03011]
    Dred_2078
   03029 Mitochondrial biogenesis [BR:drm03029]
    Dred_2078
Ribosome [BR:drm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Dred_2078
  Bacteria
    Dred_2078
Mitochondrial biogenesis [BR:drm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dred_2078
SSDB
Motif
Pfam: Ribosomal_L32p DZR Zn-ribbon_8 zinc-ribbons_6 OrfB_Zn_ribbon HypA zf-ribbon_3
Other DBs
NCBI-ProteinID: ABO50595
UniProt: A4J692
LinkDB
Position
complement(2275113..2275295)
AA seq 60 aa
MGVPKRKLAKHRGRQRRAMNMKLEAPSLVACPQCHALIQPHHLCPECGYYKNREVIAANK
NT seq 183 nt   +upstreamnt  +downstreamnt
atgggtgtaccgaaaaggaaacttgctaagcaccggggaagacagcgccgggctatgaac
atgaaattagaagcccccagcctggtagcctgcccgcagtgccatgcgctaatccaaccg
catcatctctgccctgaatgtggttactacaaaaaccgtgaagtaatcgctgctaacaag
taa

DBGET integrated database retrieval system