KEGG   Desulfotomaculum reducens: Dred_2335Help
Entry
Dred_2335         CDS       T00494                                 

Definition
(GenBank) glycosyl transferase, group 1
Organism
drm  Desulfotomaculum reducens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_5 Glyco_trans_1_2 Glycogen_syn Glyco_transf_20
Motif
Other DBs
NCBI-ProteinID: ABO50845
UniProt: A4J6Z2
LinkDB All DBs
Position
complement(2553217..2554449)
Genome map
AA seq 410 aa AA seqDB search
MRVVTFSWEYPPLSVGGLAQHVYDLTIAMARQDVDLHVITCGSPDTPDYEKIQGVHVYRV
TSFKVSSPDFVTWVMQLNMAMIERFITLFHELEQVDIIHAHDWLVAYAAKVCKHSHKIPL
ISTIHATEWGRNNGLHNDIQRHISDIEWWLTYESWRVICCSEYMQGQLTHIFQLPVDKIN
IIPNGVEPTNFKFDPKTPVKRDTFANPHEKIVYYVGRLVPEKGVQVLLEAVPKILHYHPN
TKFVIAGKGSFEGELKHKAVQIGISDKIYFTGYVNDMTRNSLYHYADVAVFPSLYEPFGI
VALEAMAAQTPVVVSDNGGLGEIVQHGFNGMKSYTGNANSLADSILHCLMDNNSARQMKE
RAYNDVIKKYNWQGIAKQTRQVYQEIIDADQKAPWKKEKLIGKVVRTVAH
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
ttgagggttgtcactttttcctgggaatacccgcccttaagtgtgggagggttagctcag
catgtctatgatttaaccattgcaatggctagacaggatgtagaccttcatgtaataacc
tgcgggagcccagatacaccagattatgaaaaaatacagggtgtgcatgtatatcgggtt
acttcttttaaggtttcttccccggattttgttacctgggttatgcagttaaacatggct
atgattgaaaggtttattaccttatttcatgaactggagcaggttgatatcatacatgcc
cacgattggttggtggcctatgcggccaaggtttgtaaacattcccacaagatccccctg
atatccactatccatgccactgagtggggacggaataacggattacataatgatattcaa
aggcacatcagtgatatcgaatggtggctaacctatgaatcctggcgcgtcatttgctgc
agtgaatacatgcaagggcagttaacccatatttttcaactacccgtagataaaataaat
attatacccaacggagtagaacccacaaactttaaatttgaccctaagacacctgtcaag
cgagatacctttgctaatccccatgagaaaattgtttattatgtgggcaggttggtacct
gagaaaggtgtacaggtactactggaggcggttccaaagatattacattatcatcctaac
accaaatttgtcatagcaggaaaggggtcatttgagggggagcttaagcataaagctgta
caaatagggatttcagataaaatctattttacaggttatgtaaatgatatgactcgaaat
agcctatatcattatgcggatgtagcagtattcccaagtttatacgagccctttggtatt
gtggccctggaagcaatggccgcccagacccctgtggtggtctctgacaatggaggtctg
ggtgaaattgtccaacacgggttcaatggcatgaagtcctatacaggtaatgccaattcc
ttggcagacagcatattgcattgcctgatggataacaattctgctcggcaaatgaaagag
cgggcttacaatgatgtgatcaaaaaatataattggcaaggtattgccaaacaaaccaga
caggtatatcaggagatcattgatgcggaccaaaaagctccctggaaaaaagaaaaatta
ataggcaaggttgttcggacagtggcccactaa

DBGET integrated database retrieval system