KEGG   Desulfotomaculum reducens: Dred_2341
Entry
Dred_2341         CDS       T00494                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00970  Aminoacyl-tRNA biosynthesis
drm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dred_2341
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:drm03029]
    Dred_2341
Enzymes [BR:drm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dred_2341
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dred_2341
Mitochondrial biogenesis [BR:drm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dred_2341
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: ABO50851
UniProt: A4J6Z8
LinkDB
Position
complement(2559819..2561276)
AA seq 485 aa
MDLFQLTAHQLHQLLTKKEISALDITEAVYNRIEQVEDKVKSYLTLTREQAEIKARQVDQ
KIAAGESIGPLAGIPIAIKDNMCTQGIRTTCASKILYNFVPPYSATSVEKVYTADMVMVG
KTNMDEFAMGSSTENSGFHLTHNPWDLDRVPGGSSGGSAAAVAAGEAIISLGSDTGGSIR
QPAALCGVVGMKPTYGSVSRYGLVAYASSLDQIGPFTRDVTDMAHVLNVICGHDPMDSTS
ANLKQTDYTQFLTNDIKGMKIGVPREYMADGIDPQVREKIKAAIQKLTELGAHVEETSMP
HTDYAMPAYYLIATAEASSNLARYDGVRYGLRVEEARDLVDMFMRSRSQGFGDEVKRRIM
LGTYSLSAGYYDAYYLKALKVRTLIKQDFDRAFEKYDALLSPTSPTTAFKIGEMVNDPIQ
MYLQDVCTIPVNLAGIPAISLPCGLANNLPVGLQLMGKAFDEGTLLRIAYTLEQNTEYTR
LRPEI
NT seq 1458 nt   +upstreamnt  +downstreamnt
ttggatctctttcagcttactgcccaccagcttcatcaactgcttacgaaaaaagaaatc
tctgcgctggatataaccgaagctgtttacaaccgtattgagcaggttgaggataaagtt
aagtcctaccttacgcttaccagggaacaggccgaaataaaggcccgacaggtggaccaa
aaaattgccgccggagagtccattggacccttggcgggtattcccattgccattaaggac
aacatgtgcacccaggggattcgtaccacctgtgcatctaagatcctttacaactttgtt
cccccatactccgccacctcagtggaaaaggtttatactgcggatatggttatggtggga
aaaaccaacatggatgaatttgccatgggttcttccacggaaaactcgggctttcattta
acccacaacccctgggatttggaccgagttcccggcgggtccagtggtggatcagctgca
gcagtggctgccggggaagcgattatttccttgggttctgacaccggtggttccattcgc
cagcctgctgccctttgcggtgtagtaggaatgaaaccaacctacggtagtgtatctcgc
tatgggctggtggcttatgcgtcctctctggatcaaattggacctttcactcgggatgtt
acagacatggcccatgtccttaacgtgatctgcggccatgacccgatggacagtacttcg
gccaatttaaaacagacagactatacccagtttcttaccaacgatattaagggtatgaaa
attggtgtgccccgggaatatatggcggacggcattgacccgcaggttagggaaaaaatc
aaagctgccatccaaaaacttacagagctgggcgctcatgttgaagaaaccagcatgccc
catacggattatgccatgccagcttattatctaattgctacagccgaggcaagctccaac
ctagcccgctatgacggagtacgctacggcctgagggttgaagaggcccgtgatttagtg
gatatgttcatgcgcagccgcagccagggctttggtgatgaagtgaagcgccgcattatg
ttgggaacctattccctgtctgcgggctactacgatgcttactatctaaaggctctaaag
gtgcgaaccctaataaaacaagactttgatcgtgcctttgaaaaatatgatgcactgtta
tcacccacttctcccacaactgcctttaaaattggagaaatggtcaatgaccccatccag
atgtatttacaggatgtttgcaccataccggtgaacttggcaggcattccggcaatctct
ctgccctgcggtctggccaataacctgcctgtgggtctgcagctaatgggcaaagccttt
gatgaaggaactcttttgagaattgcctataccttagagcaaaatacggaatatacaagg
cttcggcctgagatatag

DBGET integrated database retrieval system