KEGG   Desulfotomaculum reducens: Dred_2342Help
Entry
Dred_2342         CDS       T00494                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00970  Aminoacyl-tRNA biosynthesis
drm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dred_2342
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:drm03029]
    Dred_2342
Enzymes [BR:drm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dred_2342
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dred_2342
Mitochondrial biogenesis [BR:drm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dred_2342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ABO50852
UniProt: A4J6Z9
LinkDB All DBs
Position
complement(2561295..2561576)
Genome map
AA seq 93 aa AA seqDB search
MISKQDVEHVALLARLELKEEEKELYTQQLNKILDAARALQELNTDDVPPTAHVLPIQNV
FREDKVGKHIDPEKALANAPDREENFFKVPKIV
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
ttgattagtaaacaagatgttgagcatgtggctttgctggctcgcttggaattaaaagaa
gaggaaaaagagttgtacacccaacagttaaataaaatcctggatgcagcaagggcattg
caggaactgaatactgacgatgtgcctcccacagcccatgttctccccatacagaacgtt
tttagggaagataaggtaggaaagcatattgacccggaaaaagccctagccaatgctccg
gaccgggaagaaaacttttttaaagtgccgaaaattgtttag

DBGET integrated database retrieval system