KEGG   Desulfotomaculum reducens: Dred_2479
Entry
Dred_2479         CDS       T00494                                 

Definition
(GenBank) GTP-binding protein Era
  KO
K03595  GTPase
Organism
drm  Desulfotomaculum reducens
Brite
KEGG Orthology (KO) [BR:drm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:drm03009]
    Dred_2479
   03029 Mitochondrial biogenesis [BR:drm03029]
    Dred_2479
Ribosome biogenesis [BR:drm03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   Dred_2479
 Prokaryotic type
  GTPases
   Dred_2479
Mitochondrial biogenesis [BR:drm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dred_2479
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N GTP_EFTU Dynamin_N RsgA_GTPase AIG1 cobW Ras PduV-EutP MMR_HSR1_Xtn SRPRB Arf MeaB Roc AAA_22 ABC_tran
Other DBs
NCBI-ProteinID: ABO50989
UniProt: A4J7D6
LinkDB
Position
complement(2700966..2701874)
AA seq 302 aa
MLNTPEGYRSGFVALVGRPNVGKSTLLNKLVGQKVAIMSDKPQTTRHKIHSVLTRNDAQM
VFLDTPGIHKPRHKLGEYMVDVALGALKEVDVALFLVEASEAPGPGDQYIAEQLKGIKTP
VFLMLNKVDLIQREAVLERILQYKDLLPFAEVIPVSALAGENVERLIDTIIKYLPEGPQY
YPADMVTDRPERFIMAEIIREKVLHLTSEEIPHSVAVVVEQIKERNNGVVAVSAVIYTER
DSQKAILIGKGGNMLKEVGRRSREEIENLLGSKVFLELWVKVKKDWRNKMTDIRNFGFTK
ED
NT seq 909 nt   +upstreamnt  +downstreamnt
atgctaaatacacccgaaggatatcgctcgggttttgtggccctggtgggccgccccaat
gtggggaaatctactttactaaataagctggttggtcaaaaagtagccattatgtcggac
aaaccccagaccacccgtcataaaattcactctgtccttactagaaatgatgcccagatg
gtctttcttgatactccgggtatccataaacccaggcataaattaggagaatatatggtg
gatgtagcactgggagctctgaaagaagtagacgttgcactttttctggtggaggcatca
gaagccccaggccctggcgaccagtatattgccgagcaattaaagggtataaaaacccca
gtattcttaatgctgaacaaagtcgatctcattcaaagggaagctgtattagaaagaatc
ctccaatataaggatctgctgccctttgctgaagtgattcccgtttccgctttggccggg
gaaaacgtggagcggctcattgatacaattattaagtatttgcccgaaggacctcaatat
taccccgcagatatggtaaccgatcgacccgagcggtttatcatggcggaaatcatccgg
gaaaaggtattgcatttaaccagcgaagaaataccccattcggtggcagtggtggtagag
caaatcaaagaacgcaataacggtgtggtggctgtaagtgctgtcatttataccgagcgt
gactcccagaaggctatcttaattggtaagggtggcaacatgttgaaggaagtaggccgc
cgctcccgggaagagatcgaaaatctgctgggttctaaggtatttcttgaattatgggtt
aaggtgaagaaggattggcgcaataagatgaccgatatacgaaattttggttttaccaaa
gaagattag

DBGET integrated database retrieval system